TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|303284831|ref|XP_003061706.1| selenoprotein M [Micromonas pusilla CCMP1545] (170 letters) Database: S.arctica/genome.fa 15,618 sequences; 121,588,341 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value supercont1.1398 of Sphaeroforma arctica JP610 34 0.19 supercont1.246 of Sphaeroforma arctica JP610 29 4.6 supercont1.75 of Sphaeroforma arctica JP610 29 6.1 >supercont1.1398 of Sphaeroforma arctica JP610 Length = 15858 Score = 33.9 bits (76), Expect = 0.19 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -1 Query: 96 DDGKTEVMRENVEDWGIRKVRETLSERGFRKTDDDGGFGG 135 DD +V REN DW I + R+ + +R K DG +GG Sbjct: 10068 DDWGRKVYRENSRDWSIDENRDEIGQRRQDKDTGDGDWGG 9949 >supercont1.246 of Sphaeroforma arctica JP610 Length = 102606 Score = 29.3 bits (64), Expect = 4.6 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = -2 Query: 8 VLATLLGFLLVAVATAPAAADAARSLRAADVPAAAGARAVFV 49 + TL+ ++VA A A AAA +++ A PAAA V V Sbjct: 60302 ISVTLVVVVVVAAAAAAAAAAVTTAIKRARTPAAAAVAGVVV 60177 >supercont1.75 of Sphaeroforma arctica JP610 Length = 171072 Score = 28.9 bits (63), Expect = 6.1 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +3 Query: 131 GGFGGGGGVRRANDVNAFAAFSKSGEADRTTVR 163 GG+G GG RR + AF+A SKS T R Sbjct: 2169 GGYGTVGGRRRIRAIIAFSALSKSPLRQNPTAR 2267 Database: S.arctica/genome.fa Posted date: Nov 21, 2011 7:47 PM Number of letters in database: 121,588,341 Number of sequences in database: 15,618 Lambda K H 0.317 0.132 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,719,431 Number of Sequences: 15618 Number of extensions: 178240 Number of successful extensions: 983 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 699 Number of HSP's successfully gapped in prelim test: 30 Number of HSP's that attempted gapping in prelim test: 218 Number of HSP's gapped (non-prelim): 811 length of query: 170 length of database: 40,529,447 effective HSP length: 101 effective length of query: 69 effective length of database: 38,952,029 effective search space: 2687690001 effective search space used: 2687690001 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 61 (28.1 bits)