TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|303284831|ref|XP_003061706.1| selenoprotein M [Micromonas pusilla CCMP1545] (170 letters) Database: P.polycephalum/genome.fa 297,657 sequences; 319,018,052 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3555 10962 36554 33 0.58 Contig15402 1692 1692 33 0.76 Contig2687 16402 23132 33 0.76 Contig888 22188 27111 33 0.76 Contig147813 317 317 32 1.00 Contig15651 2681 2717 32 1.00 Contig6643 6607 15942 27 1.2 Contig165050 236 236 32 1.3 Contig163416 294 294 32 1.3 Contig3841 9108 13440 25 1.6 Contig88656 308 308 32 1.7 Contig8390 6395 6455 32 1.7 Contig758 29005 64467 32 1.7 Contig7099 6483 10279 25 2.1 Contig28077 693 693 31 2.2 Contig12561 2087 2087 31 2.2 Contig12200 2511 4503 31 2.2 Contig165435 271 271 31 2.9 Contig48340 909 909 31 2.9 Contig19744 1112 1112 31 2.9 Contig3366 11446 27854 31 2.9 Contig1104 17725 22555 31 2.9 Contig164049 241 241 26 3.5 Contig122632 476 476 30 3.8 Contig13519 3284 3304 30 3.8 Contig3811 11587 17701 30 3.8 Contig1829 15879 37145 30 3.8 Contig804 30178 39486 30 3.8 Contig122759 230 230 30 4.9 Contig55299 450 450 30 4.9 Contig54045 516 516 30 4.9 Contig20166 1302 1302 30 4.9 Contig13248 1857 1857 30 4.9 Contig6748 6185 6215 30 4.9 Contig5907 8965 13353 30 4.9 Contig4622 10252 13577 30 4.9 Contig2916 14049 29890 30 4.9 Contig2412 13292 13817 30 4.9 Contig457 35717 69149 30 4.9 Contig495 32411 32551 24 6.4 Contig88927 299 299 30 6.5 Contig20933 1374 1374 30 6.5 Contig17337 1582 1582 30 6.5 Contig17166 2736 3777 30 6.5 Contig9390 4107 5869 30 6.5 Contig4655 10604 15374 30 6.5 Contig4632 9686 9736 30 6.5 Contig4287 7957 10649 30 6.5 Contig14136 1929 1939 27 8.1 Contig965 29084 36703 25 8.1 Contig278656 675 675 29 8.4 Contig147182 371 371 29 8.4 Contig131908 849 849 29 8.4 Contig37700 677 677 29 8.4 Contig36108 655 655 29 8.4 Contig32717 1432 1442 29 8.4 Contig14296 2492 4484 29 8.4 Contig14236 1669 1669 29 8.4 Contig8364 5379 5419 29 8.4 Contig6901 6340 7940 29 8.4 Contig4431 9095 16540 29 8.4 Contig4408 12011 32117 29 8.4 Contig4343 11683 21770 29 8.4 Contig3357 13206 19371 29 8.4 Contig2748 13579 13619 29 8.4 Contig2074 15877 23599 29 8.4 Contig1468 22403 32033 29 8.4 Contig937 22888 37826 29 8.4 Contig158 41737 41927 29 8.4 Contig639 27292 57542 27 9.9 >Contig3555 10962 36554 Length = 36554 Score = 33.1 bits (74), Expect = 0.58 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = +3 Query: 114 KVRETLSERGFRKTDDDGGFGGGGG 138 +VRE + +RG K +++GG+GGGGG Sbjct: 36441 RVREVMVKRGRVKGEEEGGWGGGGG 36515 >Contig15402 1692 1692 Length = 1692 Score = 32.7 bits (73), Expect = 0.76 Identities = 21/55 (38%), Positives = 27/55 (49%) Frame = -3 Query: 95 GDDGKTEVMRENVEDWGIRKVRETLSERGFRKTDDDGGFGGGGGVRRANDVNAFA 149 G+ G+ RE E+ G R+ RE ERG R+ GGGGG R N + A Sbjct: 1555 GERGREGEEREEKEERGERERREEREERGRREE------GGGGGYRNKNRAHRVA 1409 >Contig2687 16402 23132 Length = 23132 Score = 32.7 bits (73), Expect = 0.76 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = -1 Query: 112 IRKVRETLSERGFRKTDDDGGFGGGGGV 139 I KV+E ER RK D+ GG+G GGG+ Sbjct: 1058 INKVKENQMERIRRKGDEKGGWGRGGGI 975 >Contig888 22188 27111 Length = 27111 Score = 32.7 bits (73), Expect = 0.76 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 8/42 (19%) Frame = +3 Query: 110 WGIRKVRETLSERGFRKTDDDGGF--------GGGGGVRRAN 143 W ++KVR+ + G R+ +DG GGGGGVRR N Sbjct: 16599 WQVKKVRKNERKIGVRRRREDGRIHEPDERRRGGGGGVRRDN 16724 >Contig147813 317 317 Length = 317 Score = 32.3 bits (72), Expect = 1.00 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = -1 Query: 124 FRKTDDDGGFGGGGGVRRANDVNAFAAF 151 FR + GG GGGGG RRA + F F Sbjct: 176 FRVQESKGGGGGGGGARRAKEGGGFTKF 93 >Contig15651 2681 2717 Length = 2717 Score = 32.3 bits (72), Expect = 1.00 Identities = 28/102 (27%), Positives = 42/102 (41%), Gaps = 19/102 (18%) Frame = -2 Query: 57 KRFPELKRLMKDEVEAGA---WGD---------DVTVKWEHGHPVTLVVYGDDGKTEVMR 104 K+ ++KR++K E G WG D+ K HP T+ + + Sbjct: 1399 KKKKKMKRIVKKRKEKGRGVRWGGGGGGIPIHCDIASKTRFQHP-TIAFF---------Q 1250 Query: 105 ENVEDWGIR-------KVRETLSERGFRKTDDDGGFGGGGGV 139 E DWG+R K ++ E+ K + G GGGGGV Sbjct: 1249 EVARDWGVRNLDRFGPKKKKKRKEKETEKDKGERGGGGGGGV 1124 >Contig6643 6607 15942 Length = 15942 Score = 27.3 bits (59), Expect(2) = 1.2 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 131 GGFGGGGGVRRAND 144 GG+GGGGGV RA D Sbjct: 7762 GGWGGGGGVARAPD 7721 Score = 23.1 bits (48), Expect(2) = 1.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 130 DGGFGGGGG 138 DGG GGGGG Sbjct: 7766 DGGMGGGGG 7740 >Contig165050 236 236 Length = 236 Score = 32.0 bits (71), Expect = 1.3 Identities = 17/39 (43%), Positives = 23/39 (58%) Frame = +2 Query: 117 ETLSERGFRKTDDDGGFGGGGGVRRANDVNAFAAFSKSG 155 ET+S +G + + GG GGGGGV R V + A F+ G Sbjct: 2 ETISAQGEGEGEGGGGGGGGGGVFRFGVVRSRAPFAGRG 118 >Contig163416 294 294 Length = 294 Score = 32.0 bits (71), Expect = 1.3 Identities = 18/51 (35%), Positives = 23/51 (45%) Frame = +2 Query: 88 PVTLVVYGDDGKTEVMRENVEDWGIRKVRETLSERGFRKTDDDGGFGGGGG 138 P + + G EV E+WG R E G R+ + GG GGGGG Sbjct: 137 PSVMKYVQERGVGEVEGRGGEEWGGRGEEGGREEGGGRREEGGGGGGGGGG 289 >Contig3841 9108 13440 Length = 13440 Score = 25.4 bits (54), Expect(2) = 1.6 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 Query: 126 KTDDDGGFGGGGGV 139 K +++GG GGGGGV Sbjct: 4172 KEEEEGGAGGGGGV 4213 Score = 24.6 bits (52), Expect(2) = 1.6 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 131 GGFGGGGGVRRANDV 145 GG GGGG V R ND+ Sbjct: 4192 GGGGGGGTVLRINDI 4236 >Contig88656 308 308 Length = 308 Score = 31.6 bits (70), Expect = 1.7 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = +2 Query: 98 GKTEVMRENVEDWGIRKVRETLSERGFRKTDDDGGFGGGGGVRRA 142 GK R + + G R R + ERG + + +GG GGGGG A Sbjct: 110 GKEGRERRGIGERGERGERGGIGERGEGRKEREGGRGGGGGTEGA 244 >Contig8390 6395 6455 Length = 6455 Score = 31.6 bits (70), Expect = 1.7 Identities = 19/50 (38%), Positives = 25/50 (50%) Frame = -1 Query: 95 GDDGKTEVMRENVEDWGIRKVRETLSERGFRKTDDDGGFGGGGGVRRAND 144 G G+ E E VE WG+ RE RG ++ + GGGGGV +D Sbjct: 1271 GVGGERE*EGEGVERWGVGGRRE--GRRGDGRSGEXXXXGGGGGVTFTDD 1128 >Contig758 29005 64467 Length = 64467 Score = 31.6 bits (70), Expect = 1.7 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = +2 Query: 108 EDWGIRKVRETLSERGFRKTDDDGGFGGGGG 138 +DWG + RE E G R+ ++GG GGGGG Sbjct: 64376 KDWGAGRRRE--EEGGGRRRREEGGGGGGGG 64462 >Contig7099 6483 10279 Length = 10279 Score = 25.0 bits (53), Expect(2) = 2.1 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 Query: 130 DGGFGGGGGVR 140 DGG+GGGGG R Sbjct: 9643 DGGYGGGGGGR 9675 Score = 24.6 bits (52), Expect(2) = 2.1 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +1 Query: 126 KTDDDGGFGGGGG 138 K DGG+GGGGG Sbjct: 9517 KERGDGGYGGGGG 9555 >Contig28077 693 693 Length = 693 Score = 31.2 bits (69), Expect = 2.2 Identities = 27/67 (40%), Positives = 36/67 (53%), Gaps = 8/67 (11%) Frame = -1 Query: 95 GDDG-KTEVMRENVEDWGIRKVRE--TLSERGFRKTDDDGGFGG-----GGGVRRANDVN 146 G DG K +V E ++ G + RE +ERG R+ +GG GG GGG RRA + + Sbjct: 459 GKDGRKGDVASERLQGGGRGEGREGWRWAERG-RRGGREGGGGGRAEGEGGGRRRAGEDH 283 Query: 147 AFAAFSK 153 AF A K Sbjct: 282 AFGAGGK 262 >Contig12561 2087 2087 Length = 2087 Score = 31.2 bits (69), Expect = 2.2 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 3/71 (4%) Frame = -3 Query: 96 DDGKTEVMRENVEDWGIRK-VRETLSERGFRKTDDDGGFGGGGGVR-RANDVNAFAAFSK 153 ++G+ EV V +WG+RK R + E G + + GG G +R R +D F AF + Sbjct: 1608 EEGRGEVREGGVREWGVRKRGRREMRESGRGREGERGGI--AGVLRGREHDPQGFRAFVQ 1435 Query: 154 -SGEADRTTVR 163 G+ D T + Sbjct: 1434 FVGDLDPATAQ 1402 >Contig12200 2511 4503 Length = 4503 Score = 31.2 bits (69), Expect = 2.2 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = +2 Query: 117 ETLSERGFRKTDDDGGFGGGGGVRRANDVNA 147 ET+ ERG + + GG GGGGG+ R + NA Sbjct: 737 ETVWERGGKGNER*GGGGGGGGLLRTRNSNA 829 >Contig165435 271 271 Length = 271 Score = 30.8 bits (68), Expect = 2.9 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +1 Query: 104 RENVEDWGIRKVRETLSERGFRKTDDDGGFGGGGGVR 140 R E G R+ R E G R+ ++GG GGGGG R Sbjct: 142 RRREEGGGRREERRRGEEGGGRREGEEGGGGGGGGGR 252 >Contig48340 909 909 Length = 909 Score = 30.8 bits (68), Expect = 2.9 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -2 Query: 120 SERGFRKTDDDGGFGGGGGVRR 141 SERG+ +T GG GGGGG R+ Sbjct: 899 SERGYARTGRGGGGGGGGGRRK 834 >Contig19744 1112 1112 Length = 1112 Score = 30.8 bits (68), Expect = 2.9 Identities = 15/47 (31%), Positives = 26/47 (55%) Frame = +2 Query: 94 YGDDGKTEVMRENVEDWGIRKVRETLSERGFRKTDDDGGFGGGGGVR 140 +G+ E E+ E+ R++ + +RG R+ + +GG G GGG R Sbjct: 965 WGEGEGEEDREEDGEEGEERRIERRMGKRGRREGEREGGSGEGGGRR 1105 >Contig3366 11446 27854 Length = 27854 Score = 30.8 bits (68), Expect = 2.9 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +1 Query: 121 ERGFRKTDDDGGFGGGGGVRR 141 ERG K +++GG GGGGG RR Sbjct: 4108 ERGRGKREEEGGGGGGGGKRR 4170 >Contig1104 17725 22555 Length = 22555 Score = 30.8 bits (68), Expect = 2.9 Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 7/61 (11%) Frame = +1 Query: 85 HGHP-------VTLVVYGDDGKTEVMRENVEDWGIRKVRETLSERGFRKTDDDGGFGGGG 137 H HP ++L+V+ D T + E DW + R E G R+ + GG GGGG Sbjct: 17191 HHHPSCI*FSHISLLVFID--WTLPI*ECWNDWNVETGRGRREEGGGRREEGGGGGGGGG 17364 Query: 138 G 138 G Sbjct: 17365 G 17367 >Contig164049 241 241 Length = 241 Score = 26.2 bits (56), Expect(2) = 3.5 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +3 Query: 104 RENVEDWGIRKVRETLSERGFRKTDDDGGFGGGGG 138 R + E GI +E L R+ +GG GGGGG Sbjct: 120 RNSTEQGGISAQKEVL-RTAIREEGRNGGAGGGGG 221 Score = 23.1 bits (48), Expect(2) = 3.5 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 131 GGFGGGGGVR 140 GG GGGGGVR Sbjct: 200 GGGGGGGGVR 229 >Contig122632 476 476 Length = 476 Score = 30.4 bits (67), Expect = 3.8 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = -2 Query: 95 GDDGKTEVMRENVEDWGIRKVRETLSERGFRKTDDDGGFGGGGG 138 G + + R E WG R R T ERG + + DGG G GG Sbjct: 295 GRESRGRGSRNRGESWGERGSRTTGEERGP*RIEGDGGERGMGG 164 >Contig13519 3284 3304 Length = 3304 Score = 30.4 bits (67), Expect = 3.8 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -2 Query: 42 AGARAVFVSCPSXRLKRFPELKRLMKDEVEAGAW 75 +G +FVSCPS + K++ E ++ K E G W Sbjct: 657 SGFTGIFVSCPS*KRKKWSEKEKDKKREGRGGGW 556 >Contig3811 11587 17701 Length = 17701 Score = 30.4 bits (67), Expect = 3.8 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = +1 Query: 126 KTDDDGGFGGGGGVRRANDVNAFAAFS 152 K +DDGG GGGGGV D +F+ FS Sbjct: 9841 KGEDDGGSGGGGGV----DTFSFSVFS 9909 >Contig1829 15879 37145 Length = 37145 Score = 30.4 bits (67), Expect = 3.8 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +3 Query: 121 ERGFRKTDDDGGFGGGGGVRRANDV 145 ERG +K + +GG GGGGG R D+ Sbjct: 8385 ERGGKKEEVNGGGGGGGGKRGEKDI 8459 >Contig804 30178 39486 Length = 39486 Score = 30.4 bits (67), Expect = 3.8 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = +2 Query: 114 KVRETLSERGFRKTDDDGGFGGGGGVR 140 K ++T +ERG K ++ G GGGGGVR Sbjct: 9086 KKKKTEAERGGGKKNNGRGVGGGGGVR 9166 >Contig122759 230 230 Length = 230 Score = 30.0 bits (66), Expect = 4.9 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -2 Query: 116 RETLSERGFRKTDDDGGFGGGGGVRR 141 R + ERG R ++ GG GGGGG RR Sbjct: 112 RRKVRERGRR*GEEGGGRGGGGGERR 35 >Contig55299 450 450 Length = 450 Score = 30.0 bits (66), Expect = 4.9 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = +3 Query: 113 RKVRETLSERGFRKTDDDGGFGGGGGVRRANDVN 146 RK +E ERG ++ GGGGGVRR N+ N Sbjct: 246 RKEKEKRKERGRERS------GGGGGVRRGNNSN 329 >Contig54045 516 516 Length = 516 Score = 30.0 bits (66), Expect = 4.9 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = +2 Query: 116 RETLSERGFRKTDDDGGFGGGGGVRRAND 144 RETL +R F GG GGGGGV +D Sbjct: 422 RETLRKRSFWGVGGGGGGGGGGGVGVEDD 508 >Contig20166 1302 1302 Length = 1302 Score = 30.0 bits (66), Expect = 4.9 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = -2 Query: 119 LSERGFRKTDDDGGFGGGGG 138 ++ERG R+ +D GG GGGGG Sbjct: 167 VNERGRREEEDGGGEGGGGG 108 >Contig13248 1857 1857 Length = 1857 Score = 30.0 bits (66), Expect = 4.9 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +3 Query: 104 RENVEDWGIRKVRETLSERGFRKTDDDGGFGGGGG 138 RENV W ++++RE ERG + + GG GG G Sbjct: 399 RENVY-WEVKRIREVRRERGRKMEEGRGG*GGREG 500 >Contig6748 6185 6215 Length = 6215 Score = 30.0 bits (66), Expect = 4.9 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -2 Query: 125 RKTDDDGGFGGGGGVRRANDVNAFA 149 R+ + G GGGG+RR+N N+FA Sbjct: 1042 RRRKEGAGEEGGGGIRRSNPYNSFA 968 >Contig5907 8965 13353 Length = 13353 Score = 30.0 bits (66), Expect = 4.9 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 6/58 (10%) Frame = -1 Query: 95 GDDGKTEVMRENVE------DWGIRKVRETLSERGFRKTDDDGGFGGGGGVRRANDVN 146 G++G++E RE E + G R ERG R ++G GGGGG A VN Sbjct: 2988 GEEGESEGKREGREA*GEEGEGGEEGKRRERRERGGRGGKEEGDGGGGGGEYFATLVN 2815 >Contig4622 10252 13577 Length = 13577 Score = 30.0 bits (66), Expect = 4.9 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = +3 Query: 104 RENVEDWGIRKVRETLSERGFRKTDDDGGFGGGGG 138 RE G R+ RE ERG + GG GGGGG Sbjct: 12111 REEGRQGGERRERERERERGRERGRGGGGGGGGGG 12215 >Contig2916 14049 29890 Length = 29890 Score = 30.0 bits (66), Expect = 4.9 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +1 Query: 95 GDDGKTEVMRENVEDWGIRKVRETLSERGFRKTDDDGGFGGGGGVRR 141 G +G+ E ++ N++ W + R G+R +GG G GGV R Sbjct: 8752 GSEGREEYLQHNIDGWPLFG-RRCDGHGGYRAGGGEGGGCGKGGVER 8889 >Contig2412 13292 13817 Length = 13817 Score = 30.0 bits (66), Expect = 4.9 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +3 Query: 101 EVMRENVED--WGIRKVRETLSERGFRKTDDDGGFGGGGGVRRANDVNAFAAFSK 153 E+ VE+ W + ++TL E+ ++ GG GGGG ++ + + +AAF K Sbjct: 10938 EIEESEVENKVWASTESQDTLKEKE-KERKKGGGGGGGGKAKKLDKSSIWAAFKK 11099 >Contig457 35717 69149 Length = 69149 Score = 30.0 bits (66), Expect = 4.9 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = -2 Query: 95 GDDGKTEVMRENVE-DWGIRKVRETLSERGFRKTDDDGGFGGGGG 138 G DG+ ++R+ + DW ER FRK+ + +GGGGG Sbjct: 60994 GTDGERTLLRQRISPDW----------ERRFRKSAESVSWGGGGG 60890 Score = 29.6 bits (65), Expect = 6.5 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +2 Query: 110 WGIRKVRETLSERGFRKTDDDGGFGGGGGVRR 141 WG+ R L RG R ++ GGGGG RR Sbjct: 69038 WGVSSDRTKLQARGKRGRQNEERGGGGGGGRR 69133 >Contig495 32411 32551 Length = 32551 Score = 23.9 bits (50), Expect(2) = 6.4 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 124 FRKTDDDGGFGGGGG 138 F +DGG GGGGG Sbjct: 25684 FNSKREDGGRGGGGG 25640 Score = 23.9 bits (50), Expect(2) = 6.4 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -2 Query: 130 DGGFGGGGGVRRANDVNAFAAFSKSGE 156 +GG GGGGG R D S+SGE Sbjct: 25662 EGGGGGGGGWRDEGDT------SRSGE 25600 >Contig88927 299 299 Length = 299 Score = 29.6 bits (65), Expect = 6.5 Identities = 19/53 (35%), Positives = 25/53 (47%) Frame = -2 Query: 86 GHPVTLVVYGDDGKTEVMRENVEDWGIRKVRETLSERGFRKTDDDGGFGGGGG 138 G ++ V G +GK E RE + + RE ER + GG GGGGG Sbjct: 178 GESISG*VRG*EGKRERERERERERERERERERERERERERGGGGGGGGGGGG 20 >Contig20933 1374 1374 Length = 1374 Score = 29.6 bits (65), Expect = 6.5 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +1 Query: 110 WGIRKVRETLSERGFRKTDDDGGFGGGGGV 139 WG +K RE E+ +K GG GGGGG+ Sbjct: 1189 WGYKKTREYKKEKKGKKR---GGGGGGGGI 1269 >Contig17337 1582 1582 Length = 1582 Score = 29.6 bits (65), Expect = 6.5 Identities = 37/144 (25%), Positives = 59/144 (40%), Gaps = 8/144 (5%) Frame = -1 Query: 3 SSSARVLATLLGFLLVAVATAPA--AADAARSLRAADVPAAAGARAVFVSCPSXRLKRFP 60 S + +L + FLL ++ A D+ S DV + G S R F Sbjct: 853 SKESTLLVRVKSFLLPLISFFERFDAFDSFASFEKCDVCDSFGV--------SERSNIFE 698 Query: 61 ELKRLMKDEVEAGAWGDDVTVKWEHGHPVTL----VVYGDDGKTEVMRENVEDWGIRKVR 116 + KR+ + E+ + G+ P TL V G++G+ E ++ G + Sbjct: 697 KTKRIERSEIRLRSKGEGGRAGTNEEAPYTL*AWRVGEGEEGRKE--ERETKERGEER** 524 Query: 117 ETLSERGF--RKTDDDGGFGGGGG 138 E L ++ R D+GG GGGGG Sbjct: 523 EKLVDKYKIDRGRGDEGGGGGGGG 452 >Contig17166 2736 3777 Length = 3777 Score = 29.6 bits (65), Expect = 6.5 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = -3 Query: 113 RKVRETLSERGFRKTDDDGGFGGGGGVRRAND 144 RK RE ERG R+ ++ GG GGG RR D Sbjct: 1312 RKEREERGERGERREEERGG---GGGERRRED 1226 >Contig9390 4107 5869 Length = 5869 Score = 29.6 bits (65), Expect = 6.5 Identities = 18/43 (41%), Positives = 27/43 (62%) Frame = -3 Query: 2 ASSSARVLATLLGFLLVAVATAPAAADAARSLRAADVPAAAGA 44 A++S+ V AT VAVA++ A+A +A S ++ V AAA A Sbjct: 1427 AAASSAVSATTASSSAVAVASSEASASSASSTASSAVSAAAAA 1299 >Contig4655 10604 15374 Length = 15374 Score = 29.6 bits (65), Expect = 6.5 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Frame = -3 Query: 111 GIRKVRETLSERGFRKTDDDGGFGGGGGVRRANDVNAFAAF--SKSGEADRTTVRTQP 166 G ++ RE E+G +K + GG GGG + R ++ +A +GE + T P Sbjct: 9846 GKKRKRENKKEKGEKKGEKGGGEGGGDTITRPTELALSSAVVAEGAGEGEGVTCAVVP 9673 >Contig4632 9686 9736 Length = 9736 Score = 29.6 bits (65), Expect = 6.5 Identities = 20/49 (40%), Positives = 24/49 (48%) Frame = -1 Query: 90 TLVVYGDDGKTEVMRENVEDWGIRKVRETLSERGFRKTDDDGGFGGGGG 138 TL+V GK E RE + + RE ERG + GG GGGGG Sbjct: 3181 TLLVGWSIGKVERERERERE----RERERERERGGGREGGGGGGGGGGG 3047 >Contig4287 7957 10649 Length = 10649 Score = 29.6 bits (65), Expect = 6.5 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 Query: 129 DDGGFGGGGGVRRANDVNAFAAFSKSGEADRTTVRTQ 165 ++GG GGGGGV R+ A S + T+ TQ Sbjct: 10301 EEGGGGGGGGVNRSYRCGALPRLSLKSSKGKPTI*TQ 10411 >Contig14136 1929 1939 Length = 1939 Score = 26.6 bits (57), Expect(2) = 8.1 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -3 Query: 134 GGGGGVRRANDVNAFAAFSKSGEADRTTVRTQP 166 GGGGG R+ + AFA+ + A R V+T P Sbjct: 1151 GGGGGWRKKEERYAFASSACWS*APRFIVKTHP 1053 Score = 21.2 bits (43), Expect(2) = 8.1 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -1 Query: 131 GGFGGGGGV 139 GG GGGGGV Sbjct: 1162 GGGGGGGGV 1136 >Contig965 29084 36703 Length = 36703 Score = 25.0 bits (53), Expect(2) = 8.1 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -2 Query: 134 GGGGGVRRANDV 145 GGGGGVRR N++ Sbjct: 30654 GGGGGVRRRNNI 30619 Score = 22.3 bits (46), Expect(2) = 8.1 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 125 RKTDDDGGFGGGGG 138 +K + +GG GGGGG Sbjct: 30679 KKKNKNGGGGGGGG 30638 >Contig278656 675 675 Length = 675 Score = 29.3 bits (64), Expect = 8.4 Identities = 19/47 (40%), Positives = 23/47 (48%) Frame = +2 Query: 2 ASSSARVLATLLGFLLVAVATAPAAADAARSLRAADVPAAAGARAVF 48 A+++A A A A A AAA AA + AA AAA A A F Sbjct: 182 AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAATAAF 322 >Contig147182 371 371 Length = 371 Score = 29.3 bits (64), Expect = 8.4 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 113 RKVRETLSERGFRKTDDDGGFGGGGGVRR 141 R+ R RG + +++GG GGGGG RR Sbjct: 271 RRRRRRRRRRGGGEEEEEGGGGGGGGERR 357 >Contig131908 849 849 Length = 849 Score = 29.3 bits (64), Expect = 8.4 Identities = 19/35 (54%), Positives = 21/35 (60%) Frame = -1 Query: 12 LLGFLLVAVATAPAAADAARSLRAADVPAAAGARA 46 LL LL+A A A AAA AA + AA AAA A A Sbjct: 849 LLLLLLLAAAAAAAAAAAAAAAAAAAAAAAAAAAA 745 >Contig37700 677 677 Length = 677 Score = 29.3 bits (64), Expect = 8.4 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -2 Query: 125 RKTDDDGGFGGGGGV 139 +KT++DGG GGGGGV Sbjct: 466 QKTEEDGGRGGGGGV 422 >Contig36108 655 655 Length = 655 Score = 29.3 bits (64), Expect = 8.4 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +1 Query: 132 GFGGGGGVRRANDV 145 GFGGGGG+RRA+ V Sbjct: 430 GFGGGGGIRRASSV 471 >Contig32717 1432 1442 Length = 1442 Score = 29.3 bits (64), Expect = 8.4 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -3 Query: 113 RKVRETLSERGFRKTDDDGGFGGGGG 138 RK++ RG R+ +DGG GGGGG Sbjct: 1353 RKMKRK*ERRGERER*EDGGRGGGGG 1276 >Contig14296 2492 4484 Length = 4484 Score = 29.3 bits (64), Expect = 8.4 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = -1 Query: 112 IRKVRETLSERGFRKTDDDGGFGGGGGVRRAN 143 I+KV+ SERG RK + G GGGG +R N Sbjct: 4412 IKKVKGKGSERGGRK*EGRRGEGGGGRGKRIN 4317 >Contig14236 1669 1669 Length = 1669 Score = 29.3 bits (64), Expect = 8.4 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = -3 Query: 109 DWGIRKVRETLSERGFRKTDDDGGFGGGGGV 139 DWGIR +R RGF GGFGG GG+ Sbjct: 1622 DWGIRGIRGI---RGF------GGFGGSGGL 1557 >Contig8364 5379 5419 Length = 5419 Score = 29.3 bits (64), Expect = 8.4 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = +2 Query: 109 DWGIRKVRETLSERGFRKTDDDGGFGGGGGVRRANDVNAFAAFSKS 154 +WG VR S R F GG+GGGGG R +++ + S S Sbjct: 3464 EWGCESVRLRASVR*FA---GKGGWGGGGGGRDGHNLQIIKSISCS 3592 >Contig6901 6340 7940 Length = 7940 Score = 29.3 bits (64), Expect = 8.4 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -1 Query: 125 RKTDDDGGFGGGGGVRR 141 RK D +GG GGGGG+R+ Sbjct: 665 RKNDGEGGGGGGGGLRK 615 >Contig4431 9095 16540 Length = 16540 Score = 29.3 bits (64), Expect = 8.4 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +2 Query: 98 GKTEVMRENVEDWGIRKVRETLSERGFRKTDDDGGFGGGGG 138 G+ E +R N + G +V E+G + D GG GGGGG Sbjct: 16115 GRREGVRNNEGERGAEEV-----EKGEERRGDGGGRGGGGG 16222 >Contig4408 12011 32117 Length = 32117 Score = 29.3 bits (64), Expect = 8.4 Identities = 24/72 (33%), Positives = 32/72 (44%), Gaps = 7/72 (9%) Frame = -1 Query: 89 VTLVVYGDDGKTEV------MRENVEDWG-IRKVRETLSERGFRKTDDDGGFGGGGGVRR 141 +T + GKT +RE DW I+K RE R R+ + GG GGGG RR Sbjct: 13040 LTFYFFPTSGKTNFAMEWVGIREEGRDWNEIQKERERERRREERE-GERGGRSGGGGERR 12864 Query: 142 ANDVNAFAAFSK 153 + + SK Sbjct: 12863 ERNEIPYLGKSK 12828 >Contig4343 11683 21770 Length = 21770 Score = 29.3 bits (64), Expect = 8.4 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +1 Query: 113 RKVRETLSERGFRKTDDDGGFGGGGGVRR 141 R+ R R R+ +DGG GGGGG RR Sbjct: 16744 RRRRRRRRRRRRRRRTEDGGGGGGGGRRR 16830 >Contig3357 13206 19371 Length = 19371 Score = 29.3 bits (64), Expect = 8.4 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = +2 Query: 99 KTEVMRENVEDWGIRKVRETLSERGFRKTDDDGGFGGGGG 138 +T R E WG RE + G + GG GGGGG Sbjct: 18974 RTNGKRWGAESWGGM*EREERGKEGKGRKQSGGGGGGGGG 19093 >Contig2748 13579 13619 Length = 13619 Score = 29.3 bits (64), Expect = 8.4 Identities = 18/47 (38%), Positives = 26/47 (55%) Frame = -3 Query: 91 LVVYGDDGKTEVMRENVEDWGIRKVRETLSERGFRKTDDDGGFGGGG 137 LV G+ G+ E R E R+ E ++E+G R+ + GG GGGG Sbjct: 11481 LVSTGEKGRREWQRRGRESG--REGVERVAEKGQREGAEKGGEGGGG 11347 >Contig2074 15877 23599 Length = 23599 Score = 29.3 bits (64), Expect = 8.4 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +2 Query: 126 KTDDDGGFGGGGGVRRANDVNAFAAFSKSG 155 K ++GG GGGGGV ++VN+ A S SG Sbjct: 743 KKGEEGGGGGGGGV-TDSEVNSVAMVSSSG 829 >Contig1468 22403 32033 Length = 32033 Score = 29.3 bits (64), Expect = 8.4 Identities = 22/83 (26%), Positives = 43/83 (51%), Gaps = 2/83 (2%) Frame = -3 Query: 64 RLMKDEVEAGAWGDDVTVKWEHGHPVTLVVYGDDGKTEVMRENVEDWGIRKVRETLSERG 123 RLM++++ G ++ W GH L + +R ++ + ++++ E ERG Sbjct: 29478 RLMQEDLGTGI----LSQIWHLGHTSHL*KIHMSARLIWLR*SLANLQVKEILE--GERG 29317 Query: 124 FRKTDDDGGFGG--GGGVRRAND 144 RK +++GG GG G + R++D Sbjct: 29316 RRKMEEEGGRGGREGRSIARSSD 29248 >Contig937 22888 37826 Length = 37826 Score = 29.3 bits (64), Expect = 8.4 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 111 GIRKVRETLSERGFRKTDDDGGFGGGGG 138 GI K E E G + +++GG GGGGG Sbjct: 24444 GINKGEEGEEEEGEEEGEEEGGGGGGGG 24527 >Contig158 41737 41927 Length = 41927 Score = 29.3 bits (64), Expect = 8.4 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 113 RKVRETLSERGFRKTDDDGGFGGGGGVR 140 +K ++ +G +K+ DGG GGGGG R Sbjct: 34085 KKKKKKKKGKGRKKSKSDGGVGGGGGGR 34168 >Contig639 27292 57542 Length = 57542 Score = 26.6 bits (57), Expect(2) = 9.9 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -2 Query: 132 GFGGGGGVRRANDVNAF 148 G GGGG VR AND+ F Sbjct: 24835 GGGGGGAVRSANDLRKF 24785 Score = 20.4 bits (41), Expect(2) = 9.9 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 Query: 130 DGGFGGGGG 138 +GG GGGGG Sbjct: 24839 EGGGGGGGG 24813 Database: P.polycephalum/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 319,018,052 Number of sequences in database: 297,657 Lambda K H 0.317 0.132 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,807,982 Number of Sequences: 297657 Number of extensions: 601732 Number of successful extensions: 17702 Number of sequences better than 10.0: 79 Number of HSP's better than 10.0 without gapping: 15179 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17148 length of query: 170 length of database: 106,339,350 effective HSP length: 105 effective length of query: 65 effective length of database: 75,085,365 effective search space: 4880548725 effective search space used: 4880548725 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 63 (28.9 bits)