TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|303284831|ref|XP_003061706.1| selenoprotein M [Micromonas pusilla CCMP1545] (170 letters) Database: D.fasciculatum/genome.fa 25 sequences; 31,019,208 total letters Searching.........................done Score E Sequences producing significant alignments: (bits) Value gi|328874319|gb|GL883008.1| Dictyostelium fasciculatum unplaced ... 32 0.16 gi|328875389|gb|GL883007.1| Dictyostelium fasciculatum unplaced ... 28 2.3 gi|328866594|gb|GL883026.1| Dictyostelium fasciculatum unplaced ... 28 4.0 gi|328868227|gb|GL883021.1| Dictyostelium fasciculatum unplaced ... 27 5.2 gi|328871378|gb|GL883013.1| Dictyostelium fasciculatum unplaced ... 27 6.8 gi|328869574|gb|GL883020.1| Dictyostelium fasciculatum unplaced ... 27 8.9 gi|328872098|gb|GL883010.1| Dictyostelium fasciculatum unplaced ... 27 8.9 gi|328873752|gb|GL883009.1| Dictyostelium fasciculatum unplaced ... 27 8.9 gi|328876102|gb|GL883006.1| Dictyostelium fasciculatum unplaced ... 27 8.9 >gi|328874319|gb|GL883008.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-G-o-80e12.f1-5, whole genome shotgun sequence Length = 2750715 Score = 32.3 bits (72), Expect = 0.16 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 2/63 (3%) Frame = -1 Query: 37 DVPAAAGARAVFVSCPSXRLKRFPELKRLMKDEVEAGAWGDDVTVKWEHGH--PVTLVVY 94 D+ AG V +C R+K +++L KD+ +G D+ KW+HGH P+T + Sbjct: 170364 DLVDGAGQETVDATC---RVKVLNHVEKLGKDKGGTR*FGIDLFNKWQHGHLGPLTRGLD 170194 Query: 95 GDD 97 DD Sbjct: 170193 SDD 170185 >gi|328875389|gb|GL883007.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-G-p-12c09.r1-3, whole genome shotgun sequence Length = 1770755 Score = 28.5 bits (62), Expect = 2.3 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -2 Query: 128 DDDGGFGGGGGVRRANDV 145 DDDGG GGGGG N++ Sbjct: 1760803 DDDGGGGGGGGGNGGNNI 1760750 >gi|328866594|gb|GL883026.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_EU5ZYIE02H8LDV-5, whole genome shotgun sequence Length = 1919465 Score = 27.7 bits (60), Expect = 4.0 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 5/46 (10%) Frame = +3 Query: 128 DDDGGFGGGGG-----VRRANDVNAFAAFSKSGEADRTTVRTQPIN 168 DDDGG GGGG V+ +N + ++TTV + IN Sbjct: 168792 DDDGGGGGGGDSSKTPVKASNRTTVLKNMFSTPSPNKTTVVSHNIN 168929 >gi|328868227|gb|GL883021.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_ET2XIPL01COFD4-5, whole genome shotgun sequence Length = 3468650 Score = 27.3 bits (59), Expect = 5.2 Identities = 18/40 (45%), Positives = 21/40 (52%) Frame = -3 Query: 2 ASSSARVLATLLGFLLVAVATAPAAADAARSLRAADVPAA 41 +S S+ +T L L A A A AAA AA AA PAA Sbjct: 2398203 SSDSSFFSSTFLAAGLAAAAAAGAAAAAAAGAAAATAPAA 2398084 >gi|328871378|gb|GL883013.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_ET2XIPL01CNAVH-3, whole genome shotgun sequence Length = 1908399 Score = 26.9 bits (58), Expect = 6.8 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = -1 Query: 125 RKTDDDGGFGGGGGVRRANDVNAFAAFSKSGEADRTTVRTQPI 167 RKT GG GGGGG A ++ S S TT+ + P+ Sbjct: 815241 RKTTVAGGGGGGGGADEAATSSSIGGSSSS----TTTIMSPPL 815125 >gi|328869574|gb|GL883020.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_EJPB12P01AWP9W-5, whole genome shotgun sequence Length = 629417 Score = 26.6 bits (57), Expect = 8.9 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 127 TDDDGGFGGGGGVRRANDVNAFAAFS 152 T +GG GGGGG+ AN + + FS Sbjct: 178020 TISNGGGGGGGGIIGANGIQSPVFFS 177943 >gi|328872098|gb|GL883010.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-F-a-25c12.r2-5, whole genome shotgun sequence Length = 4166812 Score = 26.6 bits (57), Expect = 8.9 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 128 DDDGGFGGGGGV 139 DD+GG GGGGGV Sbjct: 469501 DDEGGGGGGGGV 469536 >gi|328873752|gb|GL883009.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-G-o-33e01.r1-3, whole genome shotgun sequence Length = 1429294 Score = 26.6 bits (57), Expect = 8.9 Identities = 23/61 (37%), Positives = 27/61 (44%), Gaps = 7/61 (11%) Frame = +2 Query: 93 VYGDDGKTEVMR--ENVEDWGIRKVRETLSERGFRKTDDD-----GGFGGGGGVRRANDV 145 VY G R ++ +D KV T R K DDD GG GGGGGV R + Sbjct: 281324 VYKQSGYAIATRIDDSDDDNNNTKVYRTGYLRVVPKDDDDDNNGRGGGGGGGGVYRHGNN 281503 Query: 146 N 146 N Sbjct: 281504 N 281506 >gi|328876102|gb|GL883006.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-G-b-205a01.r1-3, whole genome shotgun sequence Length = 2485436 Score = 26.6 bits (57), Expect = 8.9 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +3 Query: 11 TLLGFLLVAVATAPAAADAARSLRAADVPAA 41 +L G+L VAV+ A A+A A++SL P++ Sbjct: 1853937 SLFGYLSVAVSAASASASASQSLSVCFDPSS 1854029 Database: D.fasciculatum/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 31,019,208 Number of sequences in database: 25 Lambda K H 0.317 0.132 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,731,118 Number of Sequences: 25 Number of extensions: 39032 Number of successful extensions: 458 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 396 Number of HSP's gapped (non-prelim): 207 length of query: 170 length of database: 10,339,736 effective HSP length: 93 effective length of query: 77 effective length of database: 10,337,411 effective search space: 795980647 effective search space used: 795980647 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 57 (26.6 bits)