TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|303284831|ref|XP_003061706.1| selenoprotein M [Micromonas pusilla CCMP1545] (170 letters) Database: A.rara/genome.fa 3231 sequences; 1,450,095 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|330850458|gb|ADNL01000145.1| Astrammina rara contig00152, who... 23 2.5 gi|330849976|gb|ADNL01000627.1| Astrammina rara contig00704, who... 22 5.7 gi|330848154|gb|ADNL01002449.1| Astrammina rara contig02914, who... 22 7.4 gi|330848390|gb|ADNL01002213.1| Astrammina rara contig02646, who... 22 9.7 gi|330849490|gb|ADNL01001113.1| Astrammina rara contig01306, who... 22 9.7 >gi|330850458|gb|ADNL01000145.1| Astrammina rara contig00152, whole genome shotgun sequence Length = 289 Score = 23.5 bits (49), Expect = 2.5 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 129 DDGGFGGGGGVRRANDVNAF 148 + GG+GGG + ND N F Sbjct: 198 EGGGYGGGFKLSTRNDSNVF 257 >gi|330849976|gb|ADNL01000627.1| Astrammina rara contig00704, whole genome shotgun sequence Length = 1096 Score = 22.3 bits (46), Expect = 5.7 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 127 TDDDGGFGGGGG 138 T D+ G+GGGGG Sbjct: 686 TTDNKGWGGGGG 721 >gi|330848154|gb|ADNL01002449.1| Astrammina rara contig02914, whole genome shotgun sequence Length = 13323 Score = 21.9 bits (45), Expect = 7.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 130 DGGFGGGGG 138 DGG GGGGG Sbjct: 2030 DGGGGGGGG 2004 Score = 21.6 bits (44), Expect = 9.7 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 125 RKTDDDGGF 133 R TDDDGGF Sbjct: 3599 RVTDDDGGF 3573 >gi|330848390|gb|ADNL01002213.1| Astrammina rara contig02646, whole genome shotgun sequence Length = 3281 Score = 21.6 bits (44), Expect = 9.7 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = -3 Query: 7 RVLATLLGFLLVAVATAPAAADAARSLRAADVPAAAGARAVFVSC 51 R TLL F V+ AP A++ +++L +A+ V+C Sbjct: 1953 RKYRTLLNFQRDTVSIAPTASNTSQNLTQQHRMFTVRIQALRVTC 1819 >gi|330849490|gb|ADNL01001113.1| Astrammina rara contig01306, whole genome shotgun sequence Length = 205 Score = 21.6 bits (44), Expect = 9.7 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 96 DDGKTEVMRENVEDWGIRKVRETLSE 121 D+G +E ED+ I KV T +E Sbjct: 96 DEGLSEFYAVMCEDYNIEKVSNTRTE 173 Database: A.rara/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 1,450,095 Number of sequences in database: 3231 Lambda K H 0.317 0.132 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 196,424 Number of Sequences: 3231 Number of extensions: 1874 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of query: 170 length of database: 483,365 effective HSP length: 68 effective length of query: 102 effective length of database: 263,657 effective search space: 26893014 effective search space used: 26893014 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 44 (21.6 bits)