TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Xenopus tropicalis precursor (133 letters) Database: T.congolense/genome.fa 11 sequences; 22,287,946 total letters Searching...........done Score E Sequences producing significant alignments: (bits) Value T.congo.pschr.9 26 5.0 T.congo.pschr4 26 5.0 T.congo.pschr.11 26 6.5 >T.congo.pschr.9 Length = 2092392 Score = 26.2 bits (56), Expect = 5.0 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +2 Query: 70 PELVLITSKYEELERIPLRDMKRSEIIQLLKDLGFYRKSSPDALV 114 P L L K + +R +R+ + +D YR+S PDALV Sbjct: 579899 PSLYLEEMKISSSDGNGVRKFRRTFSLVARRDWPLYRRSVPDALV 580033 >T.congo.pschr4 Length = 1343510 Score = 26.2 bits (56), Expect = 5.0 Identities = 17/52 (32%), Positives = 27/52 (51%) Frame = +2 Query: 48 AFVTDDLPLYHNLEMKHIPGADPELVLITSKYEELERIPLRDMKRSEIIQLL 99 A +T D L+++H GADP + + + L + PL RSE++ LL Sbjct: 960578 AVITGD----QRLQLRH-NGADPPIATRFAFHHHLPKQPLNCSDRSEVVFLL 960718 Score = 26.2 bits (56), Expect = 5.0 Identities = 18/57 (31%), Positives = 25/57 (43%) Frame = -3 Query: 49 FVTDDLPLYHNLEMKHIPGADPELVLITSKYEELERIPLRDMKRSEIIQLLKDLGFY 105 FV +D PL+ L PG DP R P ++ R+ ++ KD GFY Sbjct: 145608 FVAEDEPLFKGLIGDLFPGLDP------------TRAPQENLSRA-ASKVFKDKGFY 145477 >T.congo.pschr.11 Length = 4797796 Score = 25.8 bits (55), Expect = 6.5 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Frame = -1 Query: 1 MWRPL--LLLGLLQPILGYQIDWNKLDRIAR 29 MW PL + + L L ++I WNK+ IAR Sbjct: 2426047 MWLPL*FVRINSLSEALSFRIVWNKIFSIAR 2425955 Database: T.congolense/genome.fa Posted date: Nov 21, 2011 7:47 PM Number of letters in database: 22,287,946 Number of sequences in database: 11 Lambda K H 0.320 0.141 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,246,228 Number of Sequences: 11 Number of extensions: 39435 Number of successful extensions: 148 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 138 Number of HSP's gapped (non-prelim): 45 length of query: 133 length of database: 7,429,315 effective HSP length: 87 effective length of query: 46 effective length of database: 7,428,358 effective search space: 341704468 effective search space used: 341704468 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 54 (25.4 bits)