TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Xenopus tropicalis precursor (133 letters) Database: L.tarentolae/genome.fa 7267 sequences; 31,598,840 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Lt_contig6524 | | 1 to 20141 28 1.3 Lt_contig6501 | | 1 to 8634 28 1.3 Lt_contig7234 | | 1 to 3762 28 1.7 Lt_contig4284 | | 1 to 7498 27 3.8 Lt_contig4659 | | 1 to 4195 26 6.5 Lt_contig540 | | 1 to 29965 26 8.5 >Lt_contig6524 | | 1 to 20141 Length = 20141 Score = 28.5 bits (62), Expect = 1.3 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Frame = +1 Query: 49 FVTDDLPLYH--NLEMKHIPGAD-PELVLITSKYEELERIPLRDMKR 92 F DD PL L +H+ +D P V ITS YE+L R +++KR Sbjct: 18370 FTLDDSPLPEVAALIKRHVCDSDIPHWVSITSLYEQLTRAQKQEIKR 18510 >Lt_contig6501 | | 1 to 8634 Length = 8634 Score = 28.5 bits (62), Expect = 1.3 Identities = 14/32 (43%), Positives = 23/32 (71%) Frame = -1 Query: 73 VLITSKYEELERIPLRDMKRSEIIQLLKDLGF 104 +L T EEL+RIP D+ R+E++QL++D + Sbjct: 4413 ILTTLFDEELQRIPRYDL-RTELVQLVRDRSY 4321 >Lt_contig7234 | | 1 to 3762 Length = 3762 Score = 28.1 bits (61), Expect = 1.7 Identities = 14/50 (28%), Positives = 20/50 (40%) Frame = -1 Query: 16 GYQIDWNKLDRIARGKVESCGGXQLNRLKEVKAFVTDDLPLYHNLEMKHI 65 G W + R+ RG + C G R V T PL+H + +I Sbjct: 3327 GTATPWTPILRLCRGLLLPCAGVNTCRQVRVACLRTPASPLFHRVAFSYI 3178 >Lt_contig4284 | | 1 to 7498 Length = 7498 Score = 26.9 bits (58), Expect = 3.8 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = -2 Query: 32 VESCGGXQLNRLKEVKAFVTDDLPLYHNLEMKHIPGADPELVLITSKYEELERI 85 V CGG + + A V+ L + + H+P A P L ++ ++LER+ Sbjct: 7107 VSLCGGRPAAQRPQPAAQVSRQLRSHGQVHASHVPAAQPSLPVL----QDLERL 6958 >Lt_contig4659 | | 1 to 4195 Length = 4195 Score = 26.2 bits (56), Expect = 6.5 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -2 Query: 48 AFVTDDLPLYHNLEMKHIPGADPELVLITSKYEELERI 85 A+ DDL L L +H+P P+L L + +EL+ I Sbjct: 3468 AYFADDLCLLL-LRQRHVPF*QPDLTLAAHQQQELDHI 3358 >Lt_contig540 | | 1 to 29965 Length = 29965 Score = 25.8 bits (55), Expect = 8.5 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -1 Query: 28 ARGKVESCGGXQLNRLK 44 A+GKV SCG LNRLK Sbjct: 7153 AKGKVCSCGEQGLNRLK 7103 Database: L.tarentolae/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 31,598,840 Number of sequences in database: 7267 Lambda K H 0.320 0.141 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,693,889 Number of Sequences: 7267 Number of extensions: 55218 Number of successful extensions: 177 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 175 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 177 length of query: 133 length of database: 10,532,946 effective HSP length: 88 effective length of query: 45 effective length of database: 9,893,450 effective search space: 445205250 effective search space used: 445205250 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 54 (25.4 bits)