TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Xenopus tropicalis precursor (133 letters) Database: D.fasciculatum/genome.fa 25 sequences; 31,019,208 total letters Searching.........................done Score E Sequences producing significant alignments: (bits) Value gi|328866594|gb|GL883026.1| Dictyostelium fasciculatum unplaced ... 29 0.79 gi|328875389|gb|GL883007.1| Dictyostelium fasciculatum unplaced ... 28 2.3 gi|328868227|gb|GL883021.1| Dictyostelium fasciculatum unplaced ... 26 8.7 gi|328869808|gb|GL883018.1| Dictyostelium fasciculatum unplaced ... 26 8.7 gi|328872098|gb|GL883010.1| Dictyostelium fasciculatum unplaced ... 26 8.7 >gi|328866594|gb|GL883026.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_EU5ZYIE02H8LDV-5, whole genome shotgun sequence Length = 1919465 Score = 29.3 bits (64), Expect = 0.79 Identities = 20/52 (38%), Positives = 29/52 (55%) Frame = +2 Query: 27 IARGKVESCGGXQLNRLKEVKAFVTDDLPLYHNLEMKHIPGADPELVLITSK 78 IAR ++S +NRLK TD++P+Y N + I A+ ELV +T K Sbjct: 1322528 IARSALQSI---LINRLK------TDNIPVYFNKSLVAISQAENELVTLTFK 1322656 >gi|328875389|gb|GL883007.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-G-p-12c09.r1-3, whole genome shotgun sequence Length = 1770755 Score = 27.7 bits (60), Expect = 2.3 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 4/52 (7%) Frame = +3 Query: 86 PLRDMKRSEIIQLLKDLGFYR----KSSPDALVPAEFKMAPARASGDKKEDL 133 P+ D+K+ EII +KDL R ++ P EF P R K DL Sbjct: 403122 PICDLKKQEIIYTIKDLNNERWIDKRNGEQVKDPFEFINGPNRTYDQKALDL 403277 Score = 26.6 bits (57), Expect = 5.1 Identities = 22/62 (35%), Positives = 26/62 (41%), Gaps = 4/62 (6%) Frame = -1 Query: 45 EVKAFVTDDLPLYHNLEMKHIPG----ADPELVLITSKYEELERIPLRDMKRSEIIQLLK 100 ++ F D LPLY L MKHI T + EELE D E I LLK Sbjct: 706439 KIMKFAKDILPLYLPLLMKHIYSELGIRSGSRDTDTKEEEELEEDEELDQNIEETIWLLK 706260 Query: 101 DL 102 + Sbjct: 706259 KI 706254 Score = 25.8 bits (55), Expect = 8.7 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -1 Query: 53 DLPLYHNLEMKHIPGADPELVL-ITSKYEELERIPLRD 89 DLPL HNL ++ IP + +L +T L+R+ L + Sbjct: 1224554 DLPLLHNLRLRTIPRDGSKNILEMTRGLPSLKRLQLEN 1224441 >gi|328868227|gb|GL883021.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_ET2XIPL01COFD4-5, whole genome shotgun sequence Length = 3468650 Score = 25.8 bits (55), Expect = 8.7 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 27 IARGKVESCGGXQLNRLKEVKAFVTDDLPLYHNLEMK 63 ++ G + +CGG + + V A + D P+YHN +K Sbjct: 3254374 LSLGIILACGGLGIVLVPFVFARIIPDKPIYHNNILK 3254484 >gi|328869808|gb|GL883018.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-G-b-285a01.f1-5, whole genome shotgun sequence Length = 1327167 Score = 25.8 bits (55), Expect = 8.7 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -3 Query: 1 MWRPLLLLGLLQPILGYQIDWNK 23 +W P+L+L Q + YQ+ W++ Sbjct: 271795 IWMPVLILHRFQNPINYQLQWHR 271727 >gi|328872098|gb|GL883010.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-F-a-25c12.r2-5, whole genome shotgun sequence Length = 4166812 Score = 25.8 bits (55), Expect = 8.7 Identities = 17/40 (42%), Positives = 23/40 (57%) Frame = -3 Query: 72 LVLITSKYEELERIPLRDMKRSEIIQLLKDLGFYRKSSPD 111 LV TS L+ IP+ + KR +LK + YRKSSP+ Sbjct: 1284671 LVKPTSVLFPLQYIPISESKR-----ILKLVQLYRKSSPN 1284567 Database: D.fasciculatum/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 31,019,208 Number of sequences in database: 25 Lambda K H 0.320 0.141 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,340,411 Number of Sequences: 25 Number of extensions: 50341 Number of successful extensions: 194 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 169 Number of HSP's gapped (non-prelim): 78 length of query: 133 length of database: 10,339,736 effective HSP length: 89 effective length of query: 44 effective length of database: 10,337,511 effective search space: 454850484 effective search space used: 454850484 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 55 (25.8 bits)