TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= T.pseudonana 2 (250 letters) Database: S.arctica/genome.fa 15,618 sequences; 121,588,341 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value supercont1.3101 of Sphaeroforma arctica JP610 35 0.23 supercont1.310 of Sphaeroforma arctica JP610 28 0.55 supercont1.213 of Sphaeroforma arctica JP610 28 0.69 supercont1.3398 of Sphaeroforma arctica JP610 31 2.5 supercont1.1346 of Sphaeroforma arctica JP610 25 2.7 supercont1.44 of Sphaeroforma arctica JP610 23 2.8 supercont1.11 of Sphaeroforma arctica JP610 31 3.3 supercont1.372 of Sphaeroforma arctica JP610 27 3.9 supercont1.2 of Sphaeroforma arctica JP610 25 4.2 supercont1.665 of Sphaeroforma arctica JP610 30 4.3 supercont1.1456 of Sphaeroforma arctica JP610 30 5.7 supercont1.540 of Sphaeroforma arctica JP610 25 6.4 supercont1.1121 of Sphaeroforma arctica JP610 24 7.1 supercont1.1686 of Sphaeroforma arctica JP610 30 7.4 supercont1.111 of Sphaeroforma arctica JP610 30 7.4 supercont1.219 of Sphaeroforma arctica JP610 25 7.6 supercont1.201 of Sphaeroforma arctica JP610 29 9.7 supercont1.263 of Sphaeroforma arctica JP610 26 9.8 >supercont1.3101 of Sphaeroforma arctica JP610 Length = 4080 Score = 34.7 bits (78), Expect = 0.23 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -2 Query: 35 RDNSWTLPPPPPPKLEGEPTDRRQTRVDEHHRT 67 R W PPPPP +PT ++Q R++EH T Sbjct: 3302 RSTQWLHRPPPPPPSLPDPTMQQQRRIEEHLTT 3204 >supercont1.310 of Sphaeroforma arctica JP610 Length = 90417 Score = 28.5 bits (62), Expect(2) = 0.55 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +2 Query: 41 LPPPPPPKLEGEP 53 LPPPPPP L G+P Sbjct: 41192 LPPPPPPTLVGQP 41230 Score = 23.9 bits (50), Expect(2) = 7.8 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +1 Query: 35 RDNSWTLPPPPP 46 R +W PPPPP Sbjct: 31888 RTTAWACPPPPP 31923 Score = 23.5 bits (49), Expect(2) = 7.8 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +3 Query: 43 PPPPPKLEGEPTDRRQTRVDEHH 65 PPPPP L P R + HH Sbjct: 31908 PPPPPHLGWLPRHPRLHLLPHHH 31976 Score = 23.1 bits (48), Expect(2) = 0.55 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +3 Query: 15 DRKQGTKQVQSPFFFNKGQPRDNSWTLPPPPPP 47 D K G ++ F N + S PPPPPP Sbjct: 41121 DLKSGRSAIRQSRFENSRDIYNTS--CPPPPPP 41213 >supercont1.213 of Sphaeroforma arctica JP610 Length = 112709 Score = 28.1 bits (61), Expect(2) = 0.69 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = -3 Query: 24 QSPFFFNKGQPRDNSWTLPPPPPPK 48 Q+ F NK +P NS PPPPPPK Sbjct: 77715 QNIFKTNKKEP--NSQQQPPPPPPK 77647 Score = 23.1 bits (48), Expect(2) = 0.69 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -1 Query: 42 PPPPPPKL 49 PPPPPPK+ Sbjct: 77666 PPPPPPKV 77643 >supercont1.3398 of Sphaeroforma arctica JP610 Length = 3501 Score = 31.2 bits (69), Expect = 2.5 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 25 SPFFFNKGQPRDNSWTLPPPPPPKLEGEPTD 55 SPFFF Q + N + PPP P+ P+D Sbjct: 2751 SPFFFYFYQQQQNKYQRPPPTNPQFRHRPSD 2843 >supercont1.1346 of Sphaeroforma arctica JP610 Length = 16824 Score = 24.6 bits (52), Expect(2) = 2.7 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +1 Query: 37 NSWTLPPPPPPK 48 +S LPPPPPPK Sbjct: 7843 HSVCLPPPPPPK 7878 Score = 24.6 bits (52), Expect(2) = 2.7 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +2 Query: 42 PPPPPPKLEG 51 PPPPPPK +G Sbjct: 7859 PPPPPPKKKG 7888 >supercont1.44 of Sphaeroforma arctica JP610 Length = 192263 Score = 23.1 bits (48), Expect(3) = 2.8 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -3 Query: 35 RDNSWTLPPPPPP 47 R +S T PPPPPP Sbjct: 31536 RRSSSTDPPPPPP 31498 Score = 21.9 bits (45), Expect(3) = 2.8 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -1 Query: 41 LPPPPPPK 48 +PPPPPP+ Sbjct: 31517 IPPPPPPQ 31494 Score = 21.6 bits (44), Expect(3) = 2.8 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -2 Query: 42 PPPPPPKLEGEP 53 PPPPPP +P Sbjct: 31513 PPPPPPNETPKP 31478 >supercont1.11 of Sphaeroforma arctica JP610 Length = 264421 Score = 30.8 bits (68), Expect = 3.3 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = +1 Query: 39 WTLPPPPPPKLEGEPTDRRQTRVDEHHRTNQSQVVSQQVASR 80 W L PP PP PT T D H + VV + V+SR Sbjct: 50623 WNLDPPRPPSKTHIPTPVSDTSTDVPHTSANHAVV*KSVSSR 50748 >supercont1.372 of Sphaeroforma arctica JP610 Length = 81557 Score = 26.6 bits (57), Expect(2) = 3.9 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 37 NSWTLPPPPPPKL 49 NS+ +PPPPPP L Sbjct: 39422 NSYYMPPPPPPPL 39460 Score = 21.9 bits (45), Expect(2) = 3.9 Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +3 Query: 41 LPPPPPPKLE-GEPTDRRQTRVDE 63 LPPPPP L G +T +DE Sbjct: 39441 LPPPPPSSLRVGHQR*LYKTSIDE 39512 >supercont1.2 of Sphaeroforma arctica JP610 Length = 348075 Score = 25.0 bits (53), Expect(2) = 4.2 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 42 PPPPPPKLEGEPTDRRQT 59 PPPPPP + T R T Sbjct: 233558 PPPPPPPMSAACTQSRST 233611 Score = 23.1 bits (48), Expect(2) = 4.2 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 Query: 34 PRDNSWTLPPPPPP 47 P ++ T PPPPPP Sbjct: 233525 PGRSAATAPPPPPP 233566 >supercont1.665 of Sphaeroforma arctica JP610 Length = 51845 Score = 30.4 bits (67), Expect = 4.3 Identities = 19/58 (32%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Frame = +3 Query: 29 FNKGQPRDNSWTLPPPPPPKLEGEPTDRRQTRVDEHH---RTNQSQVVSQQVASRSAS 83 FN QP S P P P+L+ R Q HH + QSQ+ + Q S S Sbjct: 45126 FNHHQPPATSHRPPGGPGPRLKSRQAGRLQAPATSHHSPLTSRQSQLTTHQFCSSPLS 45299 >supercont1.1456 of Sphaeroforma arctica JP610 Length = 14890 Score = 30.0 bits (66), Expect = 5.7 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 42 PPPPPPKLEGEPTDRRQTRVDEHHRT 67 PPPP P L+ T +R RV+ H T Sbjct: 2757 PPPPTPPLQAPHTPQRNARVERPHDT 2834 >supercont1.540 of Sphaeroforma arctica JP610 Length = 62209 Score = 25.0 bits (53), Expect(2) = 6.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 Query: 42 PPPPPPKLEGEPTD 55 PPPPPP G P D Sbjct: 55280 PPPPPPSDIGPPND 55321 Score = 22.7 bits (47), Expect(2) = 6.4 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 38 SWTLPPPPPP 47 S LPPPPPP Sbjct: 55266 SSALPPPPPP 55295 >supercont1.1121 of Sphaeroforma arctica JP610 Length = 22175 Score = 24.3 bits (51), Expect(2) = 7.1 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = -2 Query: 42 PPPPPPKLE 50 PPPPPPK++ Sbjct: 15418 PPPPPPKIQ 15392 Score = 23.5 bits (49), Expect(2) = 7.1 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 31 KGQPRDNSWTLPPPPPPK 48 + +PR ++ PPPPPPK Sbjct: 15441 QSEPRHSN---PPPPPPK 15397 >supercont1.1686 of Sphaeroforma arctica JP610 Length = 12152 Score = 29.6 bits (65), Expect = 7.4 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 7/47 (14%) Frame = -2 Query: 21 KQVQSPFFFNKGQPRDNSWTLPPPPP-------PKLEGEPTDRRQTR 60 K++Q+P P+ N + PPPPP P+L P+D R Sbjct: 2134 KKIQTPSDLKVYVPKKNPPSKPPPPPPPTT*IKPRLSATPSDNHTNR 1994 >supercont1.111 of Sphaeroforma arctica JP610 Length = 153037 Score = 29.6 bits (65), Expect = 7.4 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Frame = +2 Query: 39 WTLPPPPPPKLEGEPTDRRQTRVDEHH--RTNQSQVVSQQV 77 W PPPPPP G T+RR + H +N +++S + Sbjct: 69176 WQDPPPPPPYGYGLKTERRWFQFVHHDALNSNHERIISMGI 69298 >supercont1.219 of Sphaeroforma arctica JP610 Length = 112087 Score = 24.6 bits (52), Expect(2) = 7.6 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +3 Query: 35 RDNSWTLPPPPPP 47 +D++ LPPPPPP Sbjct: 40041 QDSTHILPPPPPP 40079 Score = 22.7 bits (47), Expect(2) = 7.6 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 42 PPPPPPK 48 PPPPPPK Sbjct: 40063 PPPPPPK 40083 >supercont1.201 of Sphaeroforma arctica JP610 Length = 116257 Score = 29.3 bits (64), Expect = 9.7 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = +2 Query: 37 NSWTLPPPPPPKL 49 +SW+ PPPPPP+L Sbjct: 23702 SSWSTPPPPPPRL 23740 Score = 29.3 bits (64), Expect = 9.7 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = -3 Query: 42 PPPPPPKLEGEPTDRRQTRVDEHHR 66 PPPPPP L G T+ R+TRV R Sbjct: 80471 PPPPPPLLRG--TNLRETRVRRRFR 80403 >supercont1.263 of Sphaeroforma arctica JP610 Length = 99195 Score = 25.8 bits (55), Expect(2) = 9.8 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +3 Query: 37 NSWTLPPPPPP 47 NS +LPPPPPP Sbjct: 59472 NSTSLPPPPPP 59504 Score = 21.2 bits (43), Expect(2) = 9.8 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +1 Query: 42 PPPPPPKL 49 PPPPPP + Sbjct: 59488 PPPPPPPI 59511 Database: S.arctica/genome.fa Posted date: Nov 21, 2011 7:47 PM Number of letters in database: 121,588,341 Number of sequences in database: 15,618 Lambda K H 0.318 0.133 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,602,180 Number of Sequences: 15618 Number of extensions: 597002 Number of successful extensions: 5726 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 2461 Number of HSP's successfully gapped in prelim test: 179 Number of HSP's that attempted gapping in prelim test: 1567 Number of HSP's gapped (non-prelim): 4547 length of query: 250 length of database: 40,529,447 effective HSP length: 106 effective length of query: 144 effective length of database: 38,873,939 effective search space: 5597847216 effective search space used: 5597847216 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 64 (29.3 bits)