TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Takifugu rubripes (120 letters) Database: A.rara/genome.fa 3231 sequences; 1,450,095 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|330849788|gb|ADNL01000815.1| Astrammina rara contig00937, who... 23 1.9 gi|330849990|gb|ADNL01000613.1| Astrammina rara contig00686, who... 23 1.9 gi|330847564|gb|ADNL01003039.1| Astrammina rara contig01152, who... 23 2.5 gi|330847872|gb|ADNL01002731.1| Astrammina rara contig03220, who... 22 3.3 gi|330849521|gb|ADNL01001082.1| Astrammina rara contig01268, who... 22 5.6 gi|330850545|gb|ADNL01000058.1| Astrammina rara contig00061, who... 22 5.6 gi|330848940|gb|ADNL01001663.1| Astrammina rara contig01974, who... 21 7.3 gi|330849874|gb|ADNL01000729.1| Astrammina rara contig00833, who... 21 9.5 >gi|330849788|gb|ADNL01000815.1| Astrammina rara contig00937, whole genome shotgun sequence Length = 1059 Score = 23.1 bits (48), Expect = 1.9 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 77 EEFRFSPAKDSPFKDEE 93 +E R++ DSPFK+E+ Sbjct: 331 KEIRYATNHDSPFKEEQ 281 >gi|330849990|gb|ADNL01000613.1| Astrammina rara contig00686, whole genome shotgun sequence Length = 508 Score = 23.1 bits (48), Expect = 1.9 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +1 Query: 90 KDEEAYKPATSSPVTENASSDPKTEEKH 117 +D E Y+ A + + S DP +E+H Sbjct: 313 QDVERYEEARNHDECQQCSKDPHAKEQH 396 >gi|330847564|gb|ADNL01003039.1| Astrammina rara contig01152, whole genome shotgun sequence Length = 1140 Score = 22.7 bits (47), Expect = 2.5 Identities = 7/42 (16%), Positives = 22/42 (52%) Frame = -2 Query: 3 INRNVKAFVTQDIPLYHNLVMKHIPGADPELVLLNHYYEELD 44 +NR V+ + ++H+ +++ + + +L+ Y +L+ Sbjct: 1040 VNRPVRVVARSSVVIFHSSLLEAVSLSSAVAILMREYVGQLE 915 >gi|330847872|gb|ADNL01002731.1| Astrammina rara contig03220, whole genome shotgun sequence Length = 1679 Score = 22.3 bits (46), Expect = 3.3 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +2 Query: 16 PLYHNLVMKHIP 27 P+YHNL + H P Sbjct: 515 PVYHNLTVDHSP 550 >gi|330849521|gb|ADNL01001082.1| Astrammina rara contig01268, whole genome shotgun sequence Length = 881 Score = 21.6 bits (44), Expect = 5.6 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 19 HNLVMKHIPGADPELVLLNHYY 40 H+L ++P A P V L+H Y Sbjct: 57 HSLGNTNLPSAPP*TVCLHHIY 122 >gi|330850545|gb|ADNL01000058.1| Astrammina rara contig00061, whole genome shotgun sequence Length = 9271 Score = 21.6 bits (44), Expect = 5.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -2 Query: 28 GADPELVLLNHYY 40 G P LVL+NH Y Sbjct: 8034 GGQPPLVLVNHSY 7996 >gi|330848940|gb|ADNL01001663.1| Astrammina rara contig01974, whole genome shotgun sequence Length = 170 Score = 21.2 bits (43), Expect = 7.3 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +2 Query: 7 VKAFVTQDIPLYHNLVMKHIP 27 + A T+ + L+H LV +H+P Sbjct: 50 ILALGTRCLLLFHALVTQHVP 112 >gi|330849874|gb|ADNL01000729.1| Astrammina rara contig00833, whole genome shotgun sequence Length = 718 Score = 20.8 bits (42), Expect = 9.5 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -1 Query: 17 LYHNLVMKHIPGADPEL 33 L+H + + +PGA P L Sbjct: 706 LFHKVSKRFLPGAPPPL 656 Database: A.rara/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 1,450,095 Number of sequences in database: 3231 Lambda K H 0.312 0.132 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 155,428 Number of Sequences: 3231 Number of extensions: 1519 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of query: 120 length of database: 483,365 effective HSP length: 64 effective length of query: 56 effective length of database: 276,581 effective search space: 15488536 effective search space used: 15488536 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 42 (20.8 bits)