TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rattus novergicus (145 letters) Database: T.congolense/genome.fa 11 sequences; 22,287,946 total letters Searching...........done Score E Sequences producing significant alignments: (bits) Value T.congo.pschr.11 28 2.1 T.congo.pschr4 27 3.6 T.congo.pschr2 26 8.1 >T.congo.pschr.11 Length = 4797796 Score = 27.7 bits (60), Expect = 2.1 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -2 Query: 1 MNILLSPPPLLLLLAALVAPATSITTYRPDWNRLRGLARGRVETC 45 +N L PPP+LL L + P +S ++ + RG + TC Sbjct: 3097779 LNTLYYPPPILLALTHIGIPTSSPPSFHGVVHLTRGQQEWPIPTC 3097645 Score = 26.6 bits (57), Expect = 4.7 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 4/34 (11%) Frame = +2 Query: 8 PPLLLLLAALVAPATSITTY----RPDWNRLRGL 37 PP LL A APA S T Y DW RL L Sbjct: 3668711 PPTLLQAQATPAPANSTTIYCSPPPQDWRRLHPL 3668812 Score = 26.2 bits (56), Expect = 6.2 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 9 PLLLLLAALVAPATSITTYRPDWNRLRGLA 38 PLL+ + ++ P TS+ +R WN +R A Sbjct: 308603 PLLVYV*SVGHPTTSLLLFRGRWNNIRAYA 308692 >T.congo.pschr4 Length = 1343510 Score = 26.9 bits (58), Expect = 3.6 Identities = 24/76 (31%), Positives = 31/76 (40%) Frame = -1 Query: 67 YHNLVMKHLPGADPELVLLSRNYQELERIPLSQMTRDEINALVQELGFYRKSAPEAKVPP 126 Y + V + L G E ++ Q L R+ + LV+E GF VPP Sbjct: 342818 YADEVTRELCGTSDETTVVMFGEQLLPRLGHC------LAVLVEECGFSILDMQMVWVPP 342657 Query: 127 EYLWAPAKPPEDASDR 142 E A A PPE S R Sbjct: 342656 ETAAAYAVPPELGSGR 342609 >T.congo.pschr2 Length = 799489 Score = 25.8 bits (55), Expect = 8.1 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -2 Query: 1 MNILLSPPPLLLLLAALVAPATSITTYRPDW 31 M +LLS PPL L A L + IT++ W Sbjct: 11661 MMLLLSSPPLFLAAALLRSAFRMITSHSARW 11569 Database: T.congolense/genome.fa Posted date: Nov 21, 2011 7:47 PM Number of letters in database: 22,287,946 Number of sequences in database: 11 Lambda K H 0.318 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,372,562 Number of Sequences: 11 Number of extensions: 61071 Number of successful extensions: 332 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 291 Number of HSP's gapped (non-prelim): 95 length of query: 145 length of database: 7,429,315 effective HSP length: 88 effective length of query: 57 effective length of database: 7,428,347 effective search space: 423415779 effective search space used: 423415779 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 54 (25.4 bits)