TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rattus novergicus (145 letters) Database: A.rara/genome.fa 3231 sequences; 1,450,095 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|330847863|gb|ADNL01002740.1| Astrammina rara contig03229, who... 24 1.2 gi|330850216|gb|ADNL01000387.1| Astrammina rara contig00421, who... 23 2.0 gi|330850394|gb|ADNL01000209.1| Astrammina rara contig00219, who... 23 2.6 gi|330848000|gb|ADNL01002603.1| Astrammina rara contig03080, who... 23 3.4 gi|330849033|gb|ADNL01001570.1| Astrammina rara contig01862, who... 23 3.4 gi|330849102|gb|ADNL01001501.1| Astrammina rara contig01782, who... 23 3.4 gi|330850572|gb|ADNL01000031.1| Astrammina rara contig00032, who... 22 4.4 gi|330849874|gb|ADNL01000729.1| Astrammina rara contig00833, who... 22 7.5 gi|330848295|gb|ADNL01002308.1| Astrammina rara contig02756, who... 21 9.8 gi|330849777|gb|ADNL01000826.1| Astrammina rara contig00953, who... 21 9.8 gi|330850550|gb|ADNL01000053.1| Astrammina rara contig00056, who... 21 9.8 >gi|330847863|gb|ADNL01002740.1| Astrammina rara contig03229, whole genome shotgun sequence Length = 1037 Score = 24.3 bits (51), Expect = 1.2 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 2 NILLSPPPLLLLLAALVAPA 21 N LS PPL++ AAL+AP+ Sbjct: 907 NRTLSTPPLVISKAALLAPS 966 >gi|330850216|gb|ADNL01000387.1| Astrammina rara contig00421, whole genome shotgun sequence Length = 1448 Score = 23.5 bits (49), Expect = 2.0 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -2 Query: 67 YHNLVMKHLPGADPELVLLSRNYQELERIPLSQMTR 102 YH L ++ L + LVL+ R+ + +P S + R Sbjct: 334 YHTLHLRRLGQVELSLVLVVRHISAAQPVPQSTIPR 227 >gi|330850394|gb|ADNL01000209.1| Astrammina rara contig00219, whole genome shotgun sequence Length = 6385 Score = 23.1 bits (48), Expect = 2.6 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 34 LRGLARGRVETCGGXQLNRLKEVKAFVTQ 62 L GLAR R C G L LKE +A + + Sbjct: 5907 LIGLARFRGGQCLGEYLTALKEGEALIAK 5821 >gi|330848000|gb|ADNL01002603.1| Astrammina rara contig03080, whole genome shotgun sequence Length = 8271 Score = 22.7 bits (47), Expect = 3.4 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 71 VMKHLPGADPELVLLSRNYQELER 94 V KH PGA ++ RNY+ E+ Sbjct: 6507 VEKHFPGAQESILDWFRNYKVREQ 6578 >gi|330849033|gb|ADNL01001570.1| Astrammina rara contig01862, whole genome shotgun sequence Length = 1019 Score = 22.7 bits (47), Expect = 3.4 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 Query: 4 LLSPPPLLLLLAALVAPATSITT 26 LL PP LLL L L+ P T+ T Sbjct: 730 LLQPPLLLLPLRRLLLPQTTPKT 798 >gi|330849102|gb|ADNL01001501.1| Astrammina rara contig01782, whole genome shotgun sequence Length = 219 Score = 22.7 bits (47), Expect = 3.4 Identities = 13/23 (56%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = -1 Query: 4 LLSPPPLLLLLAALVA-PATSIT 25 +LSP P LLLL L + PA S+T Sbjct: 111 ILSPRPHLLLLRMLASPPAKSLT 43 >gi|330850572|gb|ADNL01000031.1| Astrammina rara contig00032, whole genome shotgun sequence Length = 3405 Score = 22.3 bits (46), Expect = 4.4 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 64 IQLYHNLVMKHLPGADPELVLLSR 87 I+LY +K+ P A PEL+ L + Sbjct: 1956 IELYSG*YIKYQPFAQPELLSLKK 2027 >gi|330849874|gb|ADNL01000729.1| Astrammina rara contig00833, whole genome shotgun sequence Length = 718 Score = 21.6 bits (44), Expect = 7.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 66 LYHNLVMKHLPGADPEL 82 L+H + + LPGA P L Sbjct: 706 LFHKVSKRFLPGAPPPL 656 >gi|330848295|gb|ADNL01002308.1| Astrammina rara contig02756, whole genome shotgun sequence Length = 565 Score = 21.2 bits (43), Expect = 9.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 6 SPPPLLLLLAALVAPATS 23 SP PLL++ L P+TS Sbjct: 29 SPMPLLIVPTKLAKPSTS 82 >gi|330849777|gb|ADNL01000826.1| Astrammina rara contig00953, whole genome shotgun sequence Length = 843 Score = 21.2 bits (43), Expect = 9.8 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -2 Query: 36 GLARGRVETCG 46 GL RGR E CG Sbjct: 755 GLLRGRFEQCG 723 >gi|330850550|gb|ADNL01000053.1| Astrammina rara contig00056, whole genome shotgun sequence Length = 2656 Score = 21.2 bits (43), Expect = 9.8 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 22 TSITTYRPDW 31 T TTY PDW Sbjct: 1374 THTTTYAPDW 1403 Database: A.rara/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 1,450,095 Number of sequences in database: 3231 Lambda K H 0.318 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 241,370 Number of Sequences: 3231 Number of extensions: 2579 Number of successful extensions: 12 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of query: 145 length of database: 483,365 effective HSP length: 67 effective length of query: 78 effective length of database: 266,888 effective search space: 20817264 effective search space used: 20817264 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 43 (21.2 bits)