TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Pan troglodytes (145 letters) Database: D.fasciculatum/genome.fa 25 sequences; 31,019,208 total letters Searching.........................done Score E Sequences producing significant alignments: (bits) Value gi|328868227|gb|GL883021.1| Dictyostelium fasciculatum unplaced ... 27 3.7 gi|328872098|gb|GL883010.1| Dictyostelium fasciculatum unplaced ... 27 3.7 gi|328869808|gb|GL883018.1| Dictyostelium fasciculatum unplaced ... 27 6.4 gi|328875389|gb|GL883007.1| Dictyostelium fasciculatum unplaced ... 27 6.4 gi|328864870|gb|GL883029.1| Dictyostelium fasciculatum unplaced ... 26 8.3 >gi|328868227|gb|GL883021.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_ET2XIPL01COFD4-5, whole genome shotgun sequence Length = 3468650 Score = 27.3 bits (59), Expect = 3.7 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +3 Query: 1 MSLLLPPLALLLLLA 15 M+LLLPPL LLLLLA Sbjct: 516228 MTLLLPPLPLLLLLA 516272 Score = 26.9 bits (58), Expect = 4.9 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 3/50 (6%) Frame = +3 Query: 90 EELERIPLSEMT---REEINALVQELGFYRKAAPDAQVPPEYVWAPAKPP 136 +E+E+ + E+T ++E N + GF + P VPP V++P PP Sbjct: 2266950 DEIEKAKVLELTIQMKKEENEKAKVGGF---SPPKTLVPPPIVYSPPPPP 2267090 >gi|328872098|gb|GL883010.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-F-a-25c12.r2-5, whole genome shotgun sequence Length = 4166812 Score = 27.3 bits (59), Expect = 3.7 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 Query: 1 MSLLLPPLALLLLLAALVAPATAATAYR 28 +SL PPL +LLL+ L PA AA + R Sbjct: 3562699 LSLSRPPLLILLLIDPLPEPAPAAASSR 3562782 Score = 26.2 bits (56), Expect = 8.3 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = -1 Query: 42 VETCGGXQLNRLKEVKAFVTQDIPFYHNLVMKHL 75 ++TC + N LK F Q I YH + HL Sbjct: 1996372 IQTCTTNKHNNLKRYVTFNVQIITLYHRINPSHL 1996271 >gi|328869808|gb|GL883018.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-G-b-285a01.f1-5, whole genome shotgun sequence Length = 1327167 Score = 26.6 bits (57), Expect = 6.4 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 1 MSLLLPPLALLLLLAAL 17 +SLLLPPL LLLLL L Sbjct: 273089 LSLLLPPLLLLLLLLLL 273039 Score = 26.2 bits (56), Expect = 8.3 Identities = 22/66 (33%), Positives = 30/66 (45%), Gaps = 2/66 (3%) Frame = +1 Query: 32 NRLSGLTRARVETCGGXQLN-RLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGR-RY 89 NR G T + T GG + + EV ++ F HNL+ K + ADP + R Y Sbjct: 1014688 NRTEGCTSLALYTYGGKSRHTEIIEVFQYL-----FKHNLLDKEIIAADPRIKSFHRYNY 1014852 Query: 90 EELERI 95 E L I Sbjct: 1014853 EVLHAI 1014870 >gi|328875389|gb|GL883007.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-G-p-12c09.r1-3, whole genome shotgun sequence Length = 1770755 Score = 26.6 bits (57), Expect = 6.4 Identities = 18/47 (38%), Positives = 24/47 (51%) Frame = -3 Query: 1 MSLLLPPLALLLLLAALVAPATAATAYRPDWNRLSGLTRARVETCGG 47 ++LLLPPL LLL+L + + N L + R RV TC G Sbjct: 1414311 LALLLPPLLLLLILILYIIKVLIIALFLC*SNFL*NV-RRRVITCSG 1414174 >gi|328864870|gb|GL883029.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_EUAJFUG02HR96I-5, whole genome shotgun sequence Length = 3408800 Score = 26.2 bits (56), Expect = 8.3 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +2 Query: 11 LLLLAALVAPATAATAYRPDWNRLSGLTRAR 41 +LLL A A AT A++ RP W L G R + Sbjct: 1174370 VLLLGATTAAATTASSSRPLWLLLLGGVRMK 1174462 Database: D.fasciculatum/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 31,019,208 Number of sequences in database: 25 Lambda K H 0.319 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,119,708 Number of Sequences: 25 Number of extensions: 84068 Number of successful extensions: 549 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 484 Number of HSP's gapped (non-prelim): 156 length of query: 145 length of database: 10,339,736 effective HSP length: 90 effective length of query: 55 effective length of database: 10,337,486 effective search space: 568561730 effective search space used: 568561730 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 55 (25.8 bits)