TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Pan troglodytes (145 letters) Database: A.rara/genome.fa 3231 sequences; 1,450,095 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|330850028|gb|ADNL01000575.1| Astrammina rara contig00641, who... 25 0.68 gi|330850216|gb|ADNL01000387.1| Astrammina rara contig00421, who... 23 3.4 gi|330850220|gb|ADNL01000383.1| Astrammina rara contig00416, who... 23 3.4 gi|330847872|gb|ADNL01002731.1| Astrammina rara contig03220, who... 22 7.5 gi|330849856|gb|ADNL01000747.1| Astrammina rara contig00854, who... 21 9.8 >gi|330850028|gb|ADNL01000575.1| Astrammina rara contig00641, whole genome shotgun sequence Length = 855 Score = 25.0 bits (53), Expect = 0.68 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = -2 Query: 60 VTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINAL 108 VT +P + H PG PE V GRR+ L R + R+E+ L Sbjct: 203 VTSRLPRFDIKAWCHPPGTPPESV*DGRRHSGLVR-SVPPRGRDELEVL 60 >gi|330850216|gb|ADNL01000387.1| Astrammina rara contig00421, whole genome shotgun sequence Length = 1448 Score = 22.7 bits (47), Expect = 3.4 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -2 Query: 67 YHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTR 102 YH L ++ L + LVL+ R + +P S + R Sbjct: 334 YHTLHLRRLGQVELSLVLVVRHISAAQPVPQSTIPR 227 >gi|330850220|gb|ADNL01000383.1| Astrammina rara contig00416, whole genome shotgun sequence Length = 1209 Score = 22.7 bits (47), Expect = 3.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +1 Query: 6 PPLALLLLLAALVA 19 PPL LLLLL A VA Sbjct: 1027 PPLLLLLLLYAFVA 1068 >gi|330847872|gb|ADNL01002731.1| Astrammina rara contig03220, whole genome shotgun sequence Length = 1679 Score = 21.6 bits (44), Expect = 7.5 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +2 Query: 65 PFYHNLVMKHLP 76 P YHNL + H P Sbjct: 515 PVYHNLTVDHSP 550 >gi|330849856|gb|ADNL01000747.1| Astrammina rara contig00854, whole genome shotgun sequence Length = 810 Score = 21.2 bits (43), Expect = 9.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 4 LLPPLALLLLLAALVAP 20 LLPP+ LLL+ L+ P Sbjct: 380 LLPPVLLLLVANVLLPP 330 Database: A.rara/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 1,450,095 Number of sequences in database: 3231 Lambda K H 0.319 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 232,917 Number of Sequences: 3231 Number of extensions: 2429 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of query: 145 length of database: 483,365 effective HSP length: 67 effective length of query: 78 effective length of database: 266,888 effective search space: 20817264 effective search space used: 20817264 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 43 (21.2 bits)