TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ostreococcus tauri (125 letters) Database: S.arctica/genome.fa 15,618 sequences; 121,588,341 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value supercont1.124 of Sphaeroforma arctica JP610 35 0.037 supercont1.13419 of Sphaeroforma arctica JP610 32 0.31 supercont1.3 of Sphaeroforma arctica JP610 29 2.0 supercont1.140 of Sphaeroforma arctica JP610 28 3.5 supercont1.1393 of Sphaeroforma arctica JP610 27 7.7 >supercont1.124 of Sphaeroforma arctica JP610 Length = 143253 Score = 35.0 bits (79), Expect = 0.037 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = -3 Query: 34 YARAQFQSCPGXRLNRLPEIKAFIKDVVEVGKYGDKVSVLWTHGHAPTIH 83 Y R+ + C L ++KAF DV+++ K+ L TH HAP I+ Sbjct: 80002 YHRSSVEVCDVIGLFTFDQLKAFHNDVLKIKKFSADTKSLHTHTHAPLIN 79853 >supercont1.13419 of Sphaeroforma arctica JP610 Length = 656 Score = 32.0 bits (71), Expect = 0.31 Identities = 21/54 (38%), Positives = 30/54 (55%) Frame = +1 Query: 51 PEIKAFIKDVVEVGKYGDKVSVLWTHGHAPTIHMQDDKGTNVESVVLTSEWTVD 104 PEI F DVV +GD W +GHA T H+Q K +E+++ T+ W +D Sbjct: 22 PEIGGFQPDVV----WGDFNFKAWKYGHASTNHVQRMK--TIETILRTT-WHLD 162 >supercont1.3 of Sphaeroforma arctica JP610 Length = 323879 Score = 29.3 bits (64), Expect = 2.0 Identities = 18/53 (33%), Positives = 30/53 (56%) Frame = -1 Query: 22 CASSALAESATSYARAQFQSCPGXRLNRLPEIKAFIKDVVEVGKYGDKVSVLW 74 C SS LA Y+ + F+ R+ R+P + A +KDV+ G+Y +S+L+ Sbjct: 244319 CKSSTLACRRR*YSYSAFR-----RVIRMPSLPACMKDVISPGEYILVISLLF 244176 >supercont1.140 of Sphaeroforma arctica JP610 Length = 135964 Score = 28.5 bits (62), Expect = 3.5 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -1 Query: 8 SSASFLFAFVLFLACASSALAESATSYA 35 S+ ++ FAF++F AC+S + A SYA Sbjct: 113020 SAYNY*FAFLIFFACSSKYMDSQAMSYA 112937 >supercont1.1393 of Sphaeroforma arctica JP610 Length = 15963 Score = 27.3 bits (59), Expect = 7.7 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 2/50 (4%) Frame = -2 Query: 38 QFQSCPGXRLNRLPEIKAFI--KDVVEVGKYGDKVSVLWTHGHAPTIHMQ 85 Q+ + P N LP +A+I +E +Y S LW H H H Q Sbjct: 11918 QYTTKPSNLYNVLPNHRAYIIYYQTIESIQYTTNPSSLWYHAHTNLCHGQ 11769 Database: S.arctica/genome.fa Posted date: Nov 21, 2011 7:47 PM Number of letters in database: 121,588,341 Number of sequences in database: 15,618 Lambda K H 0.318 0.130 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,385,438 Number of Sequences: 15618 Number of extensions: 208903 Number of successful extensions: 906 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 860 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 906 length of query: 125 length of database: 40,529,447 effective HSP length: 95 effective length of query: 30 effective length of database: 39,045,737 effective search space: 1171372110 effective search space used: 1171372110 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 58 (26.9 bits)