TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ostreococcus tauri (125 letters) Database: L.tarentolae/genome.fa 7267 sequences; 31,598,840 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Lt_contig2736 | | 1 to 1634 30 0.29 Lt_contig3694 | | 1 to 1501 30 0.38 Lt_contig5670 | | 1 to 12649 29 0.65 Lt_contig114 | | 1 to 6572 28 1.1 Lt_contig5540 | | 1 to 6887 28 1.9 Lt_contig374 | | 1 to 5376 27 4.2 Lt_contig5072 | | 1 to 5507 26 5.5 Lt_contig7116 | | 1 to 1942 26 5.5 Lt_contig6685 | | 1 to 10003 26 5.5 Lt_contig6204 | | 1 to 7663 26 5.5 Lt_contig922 | | 1 to 13018 26 5.5 Lt_contig2542 | | 1 to 619 26 7.2 Lt_contig2034 | | 1 to 780 26 7.2 Lt_contig1460 | | 1 to 9211 26 7.2 Lt_contig7078 | | 1 to 9442 26 7.2 Lt_contig3483 | | 1 to 10017 26 7.2 Lt_contig5884 | | 1 to 11925 25 9.4 Lt_contig4623 | | 1 to 8772 25 9.4 Lt_contig538 | | 1 to 2927 25 9.4 >Lt_contig2736 | | 1 to 1634 Length = 1634 Score = 30.4 bits (67), Expect = 0.29 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = +3 Query: 5 RRRSSASFLFAFVLFLACASSALAESATSYARAQFQSCPGXRLNRLPEIK 54 RRR+ A+ L+ LF A S + A ++ CP R +R+P +K Sbjct: 237 RRRAPATTLWRTTLF*ATRSFFQRAVVSPATMAHYEWCPAIRTSRIPRVK 386 >Lt_contig3694 | | 1 to 1501 Length = 1501 Score = 30.0 bits (66), Expect = 0.38 Identities = 21/45 (46%), Positives = 26/45 (57%), Gaps = 6/45 (13%) Frame = -1 Query: 6 RRSSASFLFAFVLF---LACAS---SALAESATSYARAQFQSCPG 44 RRS SFLFA +LF L CAS S A AT+YA + ++ G Sbjct: 1201 RRSPLSFLFAVLLFIRPLECASSFASPFAFGATTYAVGEVRAMHG 1067 >Lt_contig5670 | | 1 to 12649 Length = 12649 Score = 29.3 bits (64), Expect = 0.65 Identities = 13/30 (43%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +3 Query: 97 LTSEWTVDQVKEYLSERGFD-PIKQEKSEL 125 + S W++ ++ EY+ +RG D P EKSEL Sbjct: 1161 IPSSWSIKELLEYIRQRGIDIPSACEKSEL 1250 >Lt_contig114 | | 1 to 6572 Length = 6572 Score = 28.5 bits (62), Expect = 1.1 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 6/55 (10%) Frame = +3 Query: 1 MTVARRRSSASFLFAFVLFL---ACAS---SALAESATSYARAQFQSCPGXRLNR 49 ++ + RRS SFLFA +L + CAS S A AT+YA + ++ G + R Sbjct: 2394 LSCSPRRSPLSFLFAVLLIIRPHECASSFASPFAFGATTYAVGEVRAMHGWQWRR 2558 >Lt_contig5540 | | 1 to 6887 Length = 6887 Score = 27.7 bits (60), Expect = 1.9 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 3/35 (8%) Frame = +3 Query: 12 FLFAFVLFLACASSALAE---SATSYARAQFQSCP 43 F FAF LAC +SA+ E +A+S +R + S P Sbjct: 6093 FFFAFTCALACLNSAITETGRAASSLSRVAYVSHP 6197 >Lt_contig374 | | 1 to 5376 Length = 5376 Score = 26.6 bits (57), Expect = 4.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 5 RRRSSASFLFAFVLFLACASSALA 28 RRR S SF F+FV +AC ++ Sbjct: 268 RRRRSPSFFFSFVPHIACQGQGIS 339 >Lt_contig5072 | | 1 to 5507 Length = 5507 Score = 26.2 bits (56), Expect = 5.5 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +3 Query: 21 ACASSALAESATSYARAQFQSC 42 AC S++ A SATS +RA SC Sbjct: 3447 ACRSASAASSATSSSRAASSSC 3512 >Lt_contig7116 | | 1 to 1942 Length = 1942 Score = 26.2 bits (56), Expect = 5.5 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 13 LFAFVLFLACASSALAESATSYARAQ 38 L A + FL CAS+AL + T ARA+ Sbjct: 137 LHAKLFFLRCASTALQQDHTKCARAR 214 >Lt_contig6685 | | 1 to 10003 Length = 10003 Score = 26.2 bits (56), Expect = 5.5 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 81 TIHMQDDKGTNVESVVLTSEWTVDQVKEYLSERGFDPI 118 T+H+ DDKGT ++V + + YL RG I Sbjct: 4371 TVHLADDKGTPRDTVTFRVRVSEVPHRRYLDYRGMGGI 4484 >Lt_contig6204 | | 1 to 7663 Length = 7663 Score = 26.2 bits (56), Expect = 5.5 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +3 Query: 1 MTVARRRSSASFLFAFVLFLACASSALAESATSYAR 36 +TV + +S L+ V AC SSA+ ++T +AR Sbjct: 303 LTVPQPHASLFLLYVCVRRFACVSSAVFSASTFFAR 410 >Lt_contig922 | | 1 to 13018 Length = 13018 Score = 26.2 bits (56), Expect = 5.5 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = +1 Query: 12 FLFAFVLFLACASSALAESATSYARAQFQSCPGXRLNRL 50 F F+FVLF SA AE+ AR F SC L R+ Sbjct: 2641 FSFSFVLFCCVCLSACAEN----ARVCFSSC*RLALRRV 2745 >Lt_contig2542 | | 1 to 619 Length = 619 Score = 25.8 bits (55), Expect = 7.2 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +2 Query: 13 LFAFVLFLACASSALAESATSYARAQFQSCPGXRLNRL 50 L ++L LAC+ S S ARA +CP L L Sbjct: 464 LCVYMLLLACSRSFPPPSPLGGARASLSACPSA*LGSL 577 >Lt_contig2034 | | 1 to 780 Length = 780 Score = 25.8 bits (55), Expect = 7.2 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +1 Query: 4 ARRRSSASFLFAFVLFLACASSALAESATSYARAQFQSCP 43 A+++ S F+F F + L+ A S R FQ CP Sbjct: 613 AQQQCSPRFIFFFSVLFLSVPRPLSVRACSRVREHFQWCP 732 >Lt_contig1460 | | 1 to 9211 Length = 9211 Score = 25.8 bits (55), Expect = 7.2 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -2 Query: 7 RSSASFLFAFVLFLACAS 24 RS SF F+F+L+ ACAS Sbjct: 5622 RSFTSFFFSFLLWRACAS 5569 >Lt_contig7078 | | 1 to 9442 Length = 9442 Score = 25.8 bits (55), Expect = 7.2 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = +3 Query: 8 SSASFLFAFVLFLACASSALAESATSYARAQ 38 S+A F A LACA+SA A++A ARA+ Sbjct: 4572 SAALFSSASRSALACAASAAAQAAACSARAR 4664 >Lt_contig3483 | | 1 to 10017 Length = 10017 Score = 25.8 bits (55), Expect = 7.2 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +1 Query: 74 WTHGHAPTIHMQDDKGTNVESVVLTSEW 101 W+H H P++ Q ++ S LT W Sbjct: 9634 WSHRHVPSLSSQTERKR*AHSNALTPSW 9717 >Lt_contig5884 | | 1 to 11925 Length = 11925 Score = 25.4 bits (54), Expect = 9.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 70 VSVLWTHGHAPTIHMQDDKGTNVESVVLTS 99 V V + H T+HM+ D T + + LTS Sbjct: 11185 VGVAYGSAHVGTVHMKGDVSTRLGHIPLTS 11274 >Lt_contig4623 | | 1 to 8772 Length = 8772 Score = 25.4 bits (54), Expect = 9.4 Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 4/55 (7%) Frame = -1 Query: 67 GDKVSVLWTHG----HAPTIHMQDDKGTNVESVVLTSEWTVDQVKEYLSERGFDP 117 GD +VL +H HAP ++ ++G L + T VKE L+ P Sbjct: 6615 GDTATVLHSHASDPLHAPDACLEHERGVGSAETSLPASATSRGVKEALTNAADSP 6451 >Lt_contig538 | | 1 to 2927 Length = 2927 Score = 25.4 bits (54), Expect = 9.4 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +1 Query: 6 RRSSASFLFAFVLFLACASSALAESATSYAR 36 RRS AS FVLF A +S A+A + S AR Sbjct: 1393 RRSVASSPRVFVLFSATSSPAVAAALISGAR 1485 Database: L.tarentolae/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 31,598,840 Number of sequences in database: 7267 Lambda K H 0.318 0.130 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,329,842 Number of Sequences: 7267 Number of extensions: 79724 Number of successful extensions: 583 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 571 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 583 length of query: 125 length of database: 10,532,946 effective HSP length: 87 effective length of query: 38 effective length of database: 9,900,717 effective search space: 376227246 effective search space used: 376227246 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 54 (25.4 bits)