TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ostreococcus tauri (125 letters) Database: D.fasciculatum/genome.fa 25 sequences; 31,019,208 total letters Searching.........................done Score E Sequences producing significant alignments: (bits) Value gi|328864870|gb|GL883029.1| Dictyostelium fasciculatum unplaced ... 28 1.5 gi|328868227|gb|GL883021.1| Dictyostelium fasciculatum unplaced ... 28 2.0 gi|328870595|gb|GL883016.1| Dictyostelium fasciculatum unplaced ... 27 2.6 gi|328875389|gb|GL883007.1| Dictyostelium fasciculatum unplaced ... 27 2.6 gi|328874319|gb|GL883008.1| Dictyostelium fasciculatum unplaced ... 27 3.4 gi|328870851|gb|GL883015.1| Dictyostelium fasciculatum unplaced ... 27 4.4 gi|328872098|gb|GL883010.1| Dictyostelium fasciculatum unplaced ... 26 5.7 gi|328871378|gb|GL883013.1| Dictyostelium fasciculatum unplaced ... 26 7.5 gi|328866594|gb|GL883026.1| Dictyostelium fasciculatum unplaced ... 25 9.8 gi|328867405|gb|GL883025.1| Dictyostelium fasciculatum unplaced ... 25 9.8 >gi|328864870|gb|GL883029.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_EUAJFUG02HR96I-5, whole genome shotgun sequence Length = 3408800 Score = 28.1 bits (61), Expect = 1.5 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 6/48 (12%) Frame = +1 Query: 62 EVGKYGDKVSVLWTHGHAPTIHM------QDDKGTNVESVVLTSEWTV 103 ++G++G V VLWT GH +H +D +V + L S W V Sbjct: 1235935 QIGRFGQSV-VLWTTGHVKGLHFVWESAEKDWLANHVVHLSLLSFWNV 1236075 Score = 27.3 bits (59), Expect = 2.6 Identities = 14/60 (23%), Positives = 30/60 (50%) Frame = -2 Query: 56 FIKDVVEVGKYGDKVSVLWTHGHAPTIHMQDDKGTNVESVVLTSEWTVDQVKEYLSERGF 115 F++ +EV D+ + + +G+ +V+ V ++ +WT + + +YL E GF Sbjct: 508258 FVEPGIEVAGVNDECNYPYRYGNV----------IDVKGVDISKDWTEEILGQYLKEAGF 508109 >gi|328868227|gb|GL883021.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_ET2XIPL01COFD4-5, whole genome shotgun sequence Length = 3468650 Score = 27.7 bits (60), Expect = 2.0 Identities = 13/24 (54%), Positives = 20/24 (83%), Gaps = 1/24 (4%) Frame = +2 Query: 86 DDKGTNVESVVLTS-EWTVDQVKE 108 DDKGT V++++LTS ++ VDQ +E Sbjct: 3310970 DDKGTVVQNIILTSCQYRVDQDQE 3311041 >gi|328870595|gb|GL883016.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-G-b-143d02.r1-5, whole genome shotgun sequence Length = 656888 Score = 27.3 bits (59), Expect = 2.6 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 3/61 (4%) Frame = -1 Query: 57 IKDVVEVGKYGDKVSVLWTHGHAPTIHMQDDKGTNVES---VVLTSEWTVDQVKEYLSER 113 ++ V GK DKV +++ H H P + QDD ++ LTS V V L +R Sbjct: 421430 VETVKHCGKSDDKV-IMFLHQHYPQLVQQDDVLNYIKKYGHYYLTSILVVPDVVPPLGKR 421254 Query: 114 G 114 G Sbjct: 421253 G 421251 Score = 25.8 bits (55), Expect = 7.5 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -2 Query: 57 IKDVVEVGKYGDKVSVLWTHGHAPTIHMQDD 87 I+ V + GK DKV +++ H H P + QDD Sbjct: 425353 IETVNQCGKNDDKV-IMFLHQHYPQLLRQDD 425264 >gi|328875389|gb|GL883007.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-G-p-12c09.r1-3, whole genome shotgun sequence Length = 1770755 Score = 27.3 bits (59), Expect = 2.6 Identities = 19/62 (30%), Positives = 30/62 (48%) Frame = +2 Query: 22 CASSALAESATSYARAQFQSCPGXRLNRLPEIKAFIKDVVEVGKYGDKVSVLWTHGHAPT 81 CA +A A AT + F S P +NR ++ + + ++ DKV +L H H+ T Sbjct: 1178945 CAMTADARRATLVSLCHFPSSPNQSINRYAS-QSSVDEAPQL--LFDKVLILVYHCHSQT 1179115 Query: 82 IH 83 H Sbjct: 1179116 RH 1179121 Score = 26.6 bits (57), Expect = 4.4 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -3 Query: 104 DQVKEYLSERGFDP 117 ++V+EYL ERGFDP Sbjct: 1341663 ERVEEYLVERGFDP 1341622 >gi|328874319|gb|GL883008.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-G-o-80e12.f1-5, whole genome shotgun sequence Length = 2750715 Score = 26.9 bits (58), Expect = 3.4 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = -1 Query: 68 DKVSVLWTHGHAPTIHMQDDKGTNVESVVLTSEWTVDQVKEYLSERGFDPI 118 D+ + WT +P I +K + + LTSE +D ++ + FDP+ Sbjct: 2577753 DQRGMCWTVLDSPNITQPYNKNDTINAKYLTSEIVMDALRTLNTTFIFDPV 2577601 Score = 26.2 bits (56), Expect = 5.7 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -2 Query: 93 ESVVLTSEWTVDQVKEYLSERGFDP-IKQEKSEL 125 E V +W +D ++ ++R FDP IK ++S L Sbjct: 1127645 EKKVEKKQWAIDIIESIFTKRFFDPLIKSQQSNL 1127544 Score = 25.8 bits (55), Expect = 7.5 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = -1 Query: 80 PTIHMQDDKGTNVESVVLTSEWTVDQVKEYLSER 113 P + QDD T+ + V + WT +K+Y +++ Sbjct: 1857627 PLYYSQDDGDTSFQDFVPFNGWTTPTMKQYKTQQ 1857526 >gi|328870851|gb|GL883015.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-G-b-126g04.f1-5, whole genome shotgun sequence Length = 499581 Score = 26.6 bits (57), Expect = 4.4 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +1 Query: 5 RRRSSASFLFAFVLFLACASSALAESATSYARA 37 R RSS+SF L+C+S AL S+ ++R+ Sbjct: 267865 RIRSSSSFFSCSCKILSCSSRALFRSSARFSRS 267963 >gi|328872098|gb|GL883010.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-F-a-25c12.r2-5, whole genome shotgun sequence Length = 4166812 Score = 26.2 bits (56), Expect = 5.7 Identities = 29/102 (28%), Positives = 45/102 (44%), Gaps = 4/102 (3%) Frame = -1 Query: 18 LFLACASSALAESATSYARAQFQSCPGXRLNRLPEIKAFIKDVVEVGKYGDKVSVLWTHG 77 LF SS LAE+ SYA A + L E + V KY + ++ Sbjct: 3153415 LFSYLFSSVLAETVASYAVATAIDLKADLIITLTETGLTTR---LVSKYRPPIPIVAVTS 3153245 Query: 78 HAPTI-HMQDDKGT---NVESVVLTSEWTVDQVKEYLSERGF 115 T+ H+ +GT V+S+V T + V+ V EY ++G+ Sbjct: 3153244 WEHTVKHLMSTRGTIPLLVDSLVGTDK-LVEYVLEYAMKKGY 3153122 >gi|328871378|gb|GL883013.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_ET2XIPL01CNAVH-3, whole genome shotgun sequence Length = 1908399 Score = 25.8 bits (55), Expect = 7.5 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -2 Query: 12 FLFAFVLFLACASSALAESATS 33 FL+ F LFL C+SS+ + S +S Sbjct: 1865882 FLWCFNLFLGCSSSSSSSSGSS 1865817 >gi|328866594|gb|GL883026.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_EU5ZYIE02H8LDV-5, whole genome shotgun sequence Length = 1919465 Score = 25.4 bits (54), Expect = 9.8 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 10 ASFLFAFVLFLACASSALA 28 +SFLF FVLF C S +L+ Sbjct: 970978 SSFLFLFVLFSCCPSLSLS 970922 >gi|328867405|gb|GL883025.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_EU5ZYIE01EUG8B-5, whole genome shotgun sequence Length = 941765 Score = 25.4 bits (54), Expect = 9.8 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -2 Query: 12 FLFAFVLFLACASSALAESATSYAR 36 F F++ LFL C+SS + + ++ R Sbjct: 700804 FFFSYFLFLTCSSSKIKDFLETFGR 700730 Database: D.fasciculatum/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 31,019,208 Number of sequences in database: 25 Lambda K H 0.318 0.130 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,708,030 Number of Sequences: 25 Number of extensions: 44502 Number of successful extensions: 263 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 8 Number of HSP's that attempted gapping in prelim test: 210 Number of HSP's gapped (non-prelim): 144 length of query: 125 length of database: 10,339,736 effective HSP length: 87 effective length of query: 38 effective length of database: 10,337,561 effective search space: 392827318 effective search space used: 392827318 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 54 (25.4 bits)