TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gallus gallus (107 letters) Database: D.discoideum_AX4/genome.fa 6 sequences; 33,943,072 total letters Searching......done Score E Sequences producing significant alignments: (bits) Value gi|93569114|gb|CM000150.2| Dictyostelium discoideum AX4 chromoso... 26 4.1 gi|256541943|gb|CM000151.3| Dictyostelium discoideum AX4 chromos... 26 5.4 >gi|93569114|gb|CM000150.2| Dictyostelium discoideum AX4 chromosome 1, whole genome shotgun sequence Length = 4923596 Score = 26.2 bits (56), Expect = 4.1 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +1 Query: 54 LVLLSFRYEELERIPLSDMTREEINQLVQELGFYRKETPE 93 L+LL +EE + +PL + EE N+ V+ ++ + E Sbjct: 1355917 LLLLLLFFEEFDLLPLLEEENEEENEEVESSTYFNSSSSE 1356036 >gi|256541943|gb|CM000151.3| Dictyostelium discoideum AX4 chromosome 2, whole genome shotgun sequence Length = 8484197 Score = 25.8 bits (55), Expect = 5.4 Identities = 11/42 (26%), Positives = 26/42 (61%) Frame = -3 Query: 43 EMKHLPGADPELVLLSFRYEELERIPLSDMTREEINQLVQEL 84 ++K+L + +++ EEL+ + LS+M + +NQL+ ++ Sbjct: 2059173 DIKYLSEREQYKDIINEIKEELKLVKLSNMDEDRVNQLISKM 2059048 Database: D.discoideum_AX4/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 33,943,072 Number of sequences in database: 6 Lambda K H 0.318 0.139 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,555,912 Number of Sequences: 6 Number of extensions: 24300 Number of successful extensions: 99 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 87 Number of HSP's gapped (non-prelim): 41 length of query: 107 length of database: 11,314,357 effective HSP length: 82 effective length of query: 25 effective length of database: 11,313,865 effective search space: 282846625 effective search space used: 282846625 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 53 (25.0 bits)