TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gallus gallus (107 letters) Database: C.fasciculata/genome.fa 1089 sequences; 37,048,325 total letters Searching...................................................done Score E Sequences producing significant alignments: (bits) Value Cf_Contig1055 | | 1 to 461976 28 1.5 Cf_Contig1065 | | 1 to 188513 27 3.4 Cf_Contig1042 | | 1 to 246505 26 5.9 Cf_Contig855 | | 1 to 84550 26 5.9 Cf_Contig606 | | 1 to 135677 26 5.9 Cf_Contig1062 | | 1 to 145330 25 7.6 Cf_Contig931 | | 1 to 135679 25 7.6 Cf_Contig748 | | 1 to 29709 25 7.6 Cf_Contig1064 | | 1 to 131218 25 10.0 Cf_Contig844 | | 1 to 101419 25 10.0 >Cf_Contig1055 | | 1 to 461976 Length = 461976 Score = 27.7 bits (60), Expect = 1.5 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 4/30 (13%) Frame = -1 Query: 3 RRPPRGLARGKVETCGGXRLSR----LPEV 28 RRPPR ARG+ GG RL++ LP+V Sbjct: 190785 RRPPRNNARGRGNGNGGHRLNKRAKHLPDV 190696 Score = 25.0 bits (53), Expect = 10.0 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 Query: 1 IERRPPRGLARGKVETCGGXRLSRLPEVKAFVSQDIPL 38 + RRP RG A + GG R +RL V + +PL Sbjct: 227127 LRRRPSRGTALLADASGGGRRAARLLPVAPLLPVHVPL 227240 >Cf_Contig1065 | | 1 to 188513 Length = 188513 Score = 26.6 bits (57), Expect = 3.4 Identities = 20/71 (28%), Positives = 30/71 (42%), Gaps = 4/71 (5%) Frame = +2 Query: 1 IERRPPRGLARGKVETCGGX----RLSRLPEVKAFVSQDIPLYHNLEMKHLPGADPELVL 56 +E PP +RG + GG R++ + Q + + + +P DPE V Sbjct: 42608 VENAPPPPSSRGGTPSPGGKDRSVRIAPPFNTSSPARQMMTMQTTATYELVPAGDPESVD 42787 Query: 57 LSFRYEELERI 67 F YEE RI Sbjct: 42788 AIFDYEEYVRI 42820 >Cf_Contig1042 | | 1 to 246505 Length = 246505 Score = 25.8 bits (55), Expect = 5.9 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +2 Query: 33 SQDIPLYHNLEMKHLPGADPE 53 + +PL H L+++HLP P+ Sbjct: 65990 AHSLPLLHRLQLRHLPRRPPQ 66052 >Cf_Contig855 | | 1 to 84550 Length = 84550 Score = 25.8 bits (55), Expect = 5.9 Identities = 16/56 (28%), Positives = 26/56 (46%) Frame = +1 Query: 31 FVSQDIPLYHNLEMKHLPGADPELVLLSFRYEELERIPLSDMTREEINQLVQELGF 86 F++QD PL+ L PG DP R+P ++ + N +++E GF Sbjct: 67285 FIAQDEPLFKGLMGDLFPGLDP------------TRVPQENLAKASTN-VLKERGF 67413 >Cf_Contig606 | | 1 to 135677 Length = 135677 Score = 25.8 bits (55), Expect = 5.9 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +2 Query: 3 RRPPRGLARGKVETCG 18 R+PPRG RGKVE G Sbjct: 38339 RQPPRGAQRGKVEHGG 38386 >Cf_Contig1062 | | 1 to 145330 Length = 145330 Score = 25.4 bits (54), Expect = 7.6 Identities = 12/24 (50%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -2 Query: 5 PPRGLARGKVETCGGXRL-SRLPE 27 PPRG AR E+CG R+ R+P+ Sbjct: 101760 PPRGYARYMQESCGERRVCGRVPQ 101689 >Cf_Contig931 | | 1 to 135679 Length = 135679 Score = 25.4 bits (54), Expect = 7.6 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 4/52 (7%) Frame = +2 Query: 54 LVLLSFRYEELERIPLSDMT--REEINQLVQELGFY--RKETPEAPVPEEFQ 101 L+ ++F E++E L+ REEIN + Q+ GFY K+ + EE Q Sbjct: 27086 LIYINFL*EKVESNALTKKRKIREEINSIEQKKGFYLRSKQRGRGVLAEETQ 27241 >Cf_Contig748 | | 1 to 29709 Length = 29709 Score = 25.4 bits (54), Expect = 7.6 Identities = 12/24 (50%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -3 Query: 5 PPRGLARGKVETCGGXRL-SRLPE 27 PPRG AR E+CG R+ R+P+ Sbjct: 15493 PPRGYARYMQESCGERRVCGRVPQ 15422 >Cf_Contig1064 | | 1 to 131218 Length = 131218 Score = 25.0 bits (53), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 33 SQDIPLYHNLEMKHLPGADPELVLLSFRYEELER 66 S +I L + H P PE+ LL +R E+L + Sbjct: 71920 SLEIVANETLTVLHAPAFRPEVALLLYRCEDLRK 71819 >Cf_Contig844 | | 1 to 101419 Length = 101419 Score = 25.0 bits (53), Expect = 10.0 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 2 ERRPPRGLARGKVETCGGXRLSRL 25 ERR RG A + CGG R SRL Sbjct: 50111 ERRGRRGSAGTRCFRCGGCRQSRL 50182 Database: C.fasciculata/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 37,048,325 Number of sequences in database: 1089 Lambda K H 0.318 0.139 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,038,997 Number of Sequences: 1089 Number of extensions: 64246 Number of successful extensions: 381 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 15 Number of HSP's that attempted gapping in prelim test: 283 Number of HSP's gapped (non-prelim): 158 length of query: 107 length of database: 12,349,441 effective HSP length: 82 effective length of query: 25 effective length of database: 12,260,143 effective search space: 306503575 effective search space used: 306503575 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 53 (25.0 bits)