TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gallus gallus (107 letters) Database: A.rara/genome.fa 3231 sequences; 1,450,095 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|330847872|gb|ADNL01002731.1| Astrammina rara contig03220, who... 25 0.31 gi|330850276|gb|ADNL01000327.1| Astrammina rara contig00346, who... 25 0.31 gi|330849874|gb|ADNL01000729.1| Astrammina rara contig00833, who... 25 0.52 gi|330850203|gb|ADNL01000400.1| Astrammina rara contig00437, who... 22 2.6 gi|330850216|gb|ADNL01000387.1| Astrammina rara contig00421, who... 21 5.8 gi|330849558|gb|ADNL01001045.1| Astrammina rara contig01227, who... 21 7.6 gi|330849777|gb|ADNL01000826.1| Astrammina rara contig00953, who... 21 7.6 gi|330849178|gb|ADNL01001425.1| Astrammina rara contig01687, who... 20 9.9 gi|330850127|gb|ADNL01000476.1| Astrammina rara contig00527, who... 20 9.9 >gi|330847872|gb|ADNL01002731.1| Astrammina rara contig03220, whole genome shotgun sequence Length = 1679 Score = 25.4 bits (54), Expect = 0.31 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +2 Query: 18 GGXRLSRLPEVKAFVSQDIPLYHNLEMKHLP 48 GG + P+ P+YHNL + H P Sbjct: 458 GGVVTAEAPQTSDMCLSQSPVYHNLTVDHSP 550 >gi|330850276|gb|ADNL01000327.1| Astrammina rara contig00346, whole genome shotgun sequence Length = 477 Score = 25.4 bits (54), Expect = 0.31 Identities = 18/84 (21%), Positives = 34/84 (40%), Gaps = 16/84 (19%) Frame = +2 Query: 24 RLPEVKAFVSQDIPLYHNLEMKHLPGADPELVLLSFRYEELERI---------------- 67 + P K ++ + Y+NL + A+ + + LSF E ++ Sbjct: 86 QFPTFKYYIKETSQEYYNLALDRFYNAEDDNLWLSFPSAERNKVAEGDFITLKKEHDSVN 265 Query: 68 PLSDMTREEINQLVQELGFYRKET 91 P+++ R +I + E Y KET Sbjct: 266 PVTEEARYKIIAIENEAPLYLKET 337 >gi|330849874|gb|ADNL01000729.1| Astrammina rara contig00833, whole genome shotgun sequence Length = 718 Score = 24.6 bits (52), Expect = 0.52 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 38 LYHNLEMKHLPGADPELVLLSFRYEELE 65 L+H + + LPGA P L + + E +E Sbjct: 706 LFHKVSKRFLPGAPPPLTPATVK*ESIE 623 >gi|330850203|gb|ADNL01000400.1| Astrammina rara contig00437, whole genome shotgun sequence Length = 424 Score = 22.3 bits (46), Expect = 2.6 Identities = 9/25 (36%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = +2 Query: 79 QLVQELGFYRKETPE--APVPEEFQ 101 Q + + G+YR +TP+ +P +FQ Sbjct: 332 QSIPQFGYYRAQTPK*NQKMPTKFQ 406 >gi|330850216|gb|ADNL01000387.1| Astrammina rara contig00421, whole genome shotgun sequence Length = 1448 Score = 21.2 bits (43), Expect = 5.8 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = -2 Query: 39 YHNLEMKHLPGADPELVLLSFRYEELERIPLSDMTR 74 YH L ++ L + LVL+ + +P S + R Sbjct: 334 YHTLHLRRLGQVELSLVLVVRHISAAQPVPQSTIPR 227 >gi|330849558|gb|ADNL01001045.1| Astrammina rara contig01227, whole genome shotgun sequence Length = 348 Score = 20.8 bits (42), Expect = 7.6 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 22 LSRLPEVKAFVSQDIPLYHNL 42 L L E+ FVS DIP+++ + Sbjct: 185 LRNLYELYKFVSIDIPIHNGI 123 >gi|330849777|gb|ADNL01000826.1| Astrammina rara contig00953, whole genome shotgun sequence Length = 843 Score = 20.8 bits (42), Expect = 7.6 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -2 Query: 4 RPPRGLARGKVETCGGXRLSRL 25 R GL RG+ E CG + R+ Sbjct: 767 RECEGLLRGRFEQCGDIKEIRV 702 >gi|330849178|gb|ADNL01001425.1| Astrammina rara contig01687, whole genome shotgun sequence Length = 430 Score = 20.4 bits (41), Expect = 9.9 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 21 RLSRLPEVKAFVSQDIPLY 39 RLS P VK FVS + Y Sbjct: 342 RLSAEPLVKNFVSPQVKYY 398 >gi|330850127|gb|ADNL01000476.1| Astrammina rara contig00527, whole genome shotgun sequence Length = 239 Score = 20.4 bits (41), Expect = 9.9 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 26 PEVKAFVSQDIPLYHNL 42 P + ++Q IP YH+L Sbjct: 25 PRTASKLAQQIPAYHSL 75 Database: A.rara/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 1,450,095 Number of sequences in database: 3231 Lambda K H 0.318 0.139 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 147,762 Number of Sequences: 3231 Number of extensions: 1480 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of query: 107 length of database: 483,365 effective HSP length: 63 effective length of query: 44 effective length of database: 279,812 effective search space: 12311728 effective search space used: 12311728 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 41 (20.4 bits)