TBLASTN 2.2.13 [Nov-27-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= SPP00000017_1.0 # Protein # Selenoprotein M (SelM) # Homo
sapiens # Complete
         (145 letters)

Database: P.polycephalum/genome.fa 
           297,657 sequences; 319,018,052 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Contig39280  635 635                                                   32   0.67 

>Contig39280  635 635
          Length = 635

 Score = 32.3 bits (72), Expect = 0.67
 Identities = 23/61 (37%), Positives = 31/61 (50%), Gaps = 17/61 (27%)
 Frame = -1

Query: 1   MSLLLPPLALLLLLAALVAPA-----------------TAATAYRPDWNRLSGLTRARVE 43
           +S LL PL LLL L +L++P                  T+AT +R + NRLS   RAR+ 
Sbjct: 230 LSSLLSPLFLLLFLFSLLSPLSSLAYVFPARKACDDWLTSATRFRLEVNRLSHAFRARIA 51

Query: 44  T 44
           T
Sbjct: 50  T 48


  Database: P.polycephalum/genome.fa
    Posted date:  Nov 21, 2011  7:46 PM
  Number of letters in database: 319,018,052
  Number of sequences in database:  297,657
  
Lambda     K      H
   0.319    0.136    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 59,850,234
Number of Sequences: 297657
Number of extensions: 1038964
Number of successful extensions: 4797
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4545
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4783
length of query: 145
length of database: 106,339,350
effective HSP length: 102
effective length of query: 43
effective length of database: 75,978,336
effective search space: 3267068448
effective search space used: 3267068448
frameshift window, decay const: 40,  0.1
T: 13
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)