TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= seed9.A0APL6_DROME/73-150 (78 letters) Database: D.fasciculatum/genome.fa 25 sequences; 31,019,208 total letters Searching.........................done Score E Sequences producing significant alignments: (bits) Value gi|328866594|gb|GL883026.1| Dictyostelium fasciculatum unplaced ... 43 3e-05 gi|328868227|gb|GL883021.1| Dictyostelium fasciculatum unplaced ... 26 3.8 gi|328870851|gb|GL883015.1| Dictyostelium fasciculatum unplaced ... 26 3.8 gi|328875389|gb|GL883007.1| Dictyostelium fasciculatum unplaced ... 25 6.4 >gi|328866594|gb|GL883026.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_EU5ZYIE02H8LDV-5, whole genome shotgun sequence Length = 1919465 Score = 43.1 bits (100), Expect = 3e-05 Identities = 22/70 (31%), Positives = 41/70 (58%) Frame = -3 Query: 2 KAILEVCTCKFRAYPQIQAFIQSGRPAKFPNLQIKYVRGLDPVVKLLDASGKVQETLSIT 61 KAIL +C + A+P I+ F+ + ++ + ++ G +P ++L D+ G ET++I Sbjct: 177096 KAILYICR*RMGAFPHIKEFVDK-KAREYTKFEHQHEPGANPRLELHDSEG-ATETINIE 176923 Query: 62 KWNTDTVEEF 71 W T+ +EEF Sbjct: 176922 SWKTEHLEEF 176893 >gi|328868227|gb|GL883021.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_ET2XIPL01COFD4-5, whole genome shotgun sequence Length = 3468650 Score = 26.2 bits (56), Expect = 3.8 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 9 TCKFRAYPQIQAFIQSGRPAKFP 31 TC R+ P IQA S RP+K P Sbjct: 2564380 TCSRRSLPTIQACCLSARPSKRP 2564312 >gi|328870851|gb|GL883015.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-G-b-126g04.f1-5, whole genome shotgun sequence Length = 499581 Score = 26.2 bits (56), Expect = 3.8 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +2 Query: 41 LDPVVKLLDASGKVQETLSITK-WNTDTVEEFFET 74 LDP L A+ ET++ K W TDTVE++ T Sbjct: 468461 LDPSPPTLFATNLTNETINQRKKWFTDTVEKYSPT 468565 >gi|328875389|gb|GL883007.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-G-p-12c09.r1-3, whole genome shotgun sequence Length = 1770755 Score = 25.4 bits (54), Expect = 6.4 Identities = 16/74 (21%), Positives = 34/74 (45%), Gaps = 19/74 (25%) Frame = -3 Query: 14 AYPQIQAFIQSGRPAKF------------PNLQIKYVRGLD-------PVVKLLDASGKV 54 AY Q+ F+ + + ++ PNL+ Y++G+D +VK+++ + Sbjct: 1466727 AYQQVNYFVNNNQQERYGMFDYSILPLFLPNLKTIYIKGVDASKEAIQDIVKVINLFPHI 1466548 Query: 55 QETLSITKWNTDTV 68 Q L +T ++ V Sbjct: 1466547 QVILHMTIYSQSNV 1466506 Database: D.fasciculatum/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 31,019,208 Number of sequences in database: 25 Lambda K H 0.321 0.135 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,359,421 Number of Sequences: 25 Number of extensions: 19219 Number of successful extensions: 83 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 75 Number of HSP's gapped (non-prelim): 27 length of query: 78 length of database: 10,339,736 effective HSP length: 53 effective length of query: 25 effective length of database: 10,338,411 effective search space: 258460275 effective search space used: 258460275 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 52 (24.6 bits)