TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|241685802|ref|XP_002412809.1| salivary selenoprotein precursor, putative [Ixodes scapularis] (150 letters) Database: A.rara/genome.fa 3231 sequences; 1,450,095 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|330850194|gb|ADNL01000409.1| Astrammina rara contig00447, who... 24 1.6 gi|330850545|gb|ADNL01000058.1| Astrammina rara contig00061, who... 24 1.6 gi|330847923|gb|ADNL01002680.1| Astrammina rara contig03164, who... 23 2.7 gi|330848016|gb|ADNL01002587.1| Astrammina rara contig03062, who... 23 2.7 gi|330847390|gb|ADNL01003213.1| Astrammina rara contig02625, who... 22 4.7 gi|330848320|gb|ADNL01002283.1| Astrammina rara contig02726, who... 22 8.0 gi|330848585|gb|ADNL01002018.1| Astrammina rara contig02402, who... 22 8.0 >gi|330850194|gb|ADNL01000409.1| Astrammina rara contig00447, whole genome shotgun sequence Length = 760 Score = 23.9 bits (50), Expect = 1.6 Identities = 18/66 (27%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Frame = -1 Query: 22 SADECLALGFRKPDLACASCRGL-AAFDLDLLRDGCHRCCAHTQDRDAPKRYPRAVLEVC 80 S + C A + +P +AC + AAF CC T++ P+R R V Sbjct: 598 SNNNCWAKPYLQPGVACQNNHQEGAAF-------ATRECCGQTRNPSCPQRVWRGHHSVI 440 Query: 81 ACKFGH 86 C H Sbjct: 439 RCSPTH 422 >gi|330850545|gb|ADNL01000058.1| Astrammina rara contig00061, whole genome shotgun sequence Length = 9271 Score = 23.9 bits (50), Expect = 1.6 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = -1 Query: 33 KPDLACASCRGLAAFDLDLLRDGCHRC 59 KP C C+ A + RD C RC Sbjct: 3205 KP*QKCTQCKSNTALE*ATQRDRCDRC 3125 >gi|330847923|gb|ADNL01002680.1| Astrammina rara contig03164, whole genome shotgun sequence Length = 2986 Score = 23.1 bits (48), Expect = 2.7 Identities = 11/35 (31%), Positives = 15/35 (42%) Frame = +3 Query: 61 AHTQDRDAPKRYPRAVLEVCACKFGHMPQIEAFVR 95 +HTQ A +R + C +GH E F R Sbjct: 555 SHTQSTHAVQRQTKGEYVARGCTYGHSYAAECF*R 659 >gi|330848016|gb|ADNL01002587.1| Astrammina rara contig03062, whole genome shotgun sequence Length = 1906 Score = 23.1 bits (48), Expect = 2.7 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = -3 Query: 14 PLFALGDLSADECLALGFRKPDLACASCRGLAAFDL 49 P FAL ++ ++ F + C SC+ +F + Sbjct: 197 PAFALSTIACSLIVSCSFSNSSILCNSCKRNNSFSI 90 >gi|330847390|gb|ADNL01003213.1| Astrammina rara contig02625, whole genome shotgun sequence Length = 13634 Score = 22.3 bits (46), Expect = 4.7 Identities = 5/11 (45%), Positives = 8/11 (72%) Frame = -2 Query: 56 CHRCCAHTQDR 66 CH+CC H + + Sbjct: 421 CHKCCRHLKSK 389 >gi|330848320|gb|ADNL01002283.1| Astrammina rara contig02726, whole genome shotgun sequence Length = 1126 Score = 21.6 bits (44), Expect = 8.0 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +3 Query: 35 DLACASCRGLAAFDL 49 D+AC C GL+ F L Sbjct: 1005 DVACGGCGGLSEFVL 1049 >gi|330848585|gb|ADNL01002018.1| Astrammina rara contig02402, whole genome shotgun sequence Length = 238 Score = 21.6 bits (44), Expect = 8.0 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -1 Query: 57 HRCCAHTQDRDAPKRYPRAVLEVCACKF 84 HR HT+ R KR + + CKF Sbjct: 148 HRQGRHTRSRHLRKRKNEN*INIVMCKF 65 Database: A.rara/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 1,450,095 Number of sequences in database: 3231 Lambda K H 0.327 0.143 0.454 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 288,305 Number of Sequences: 3231 Number of extensions: 4319 Number of successful extensions: 18 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of query: 150 length of database: 483,365 effective HSP length: 67 effective length of query: 83 effective length of database: 266,888 effective search space: 22151704 effective search space used: 22151704 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 43 (21.2 bits)