TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= seed8.Q4PMT2_IXOSC/73-150 (78 letters) Database: L.tarentolae/genome.fa 7267 sequences; 31,598,840 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Lt_contig59 | | 1 to 9375 28 0.78 Lt_contig1530 | | 1 to 14591 25 6.6 Lt_contig1274 | | 1 to 5865 25 8.6 Lt_contig6793 | | 1 to 7690 25 8.6 Lt_contig3625 | | 1 to 2940 25 8.6 >Lt_contig59 | | 1 to 9375 Length = 9375 Score = 28.5 bits (62), Expect = 0.78 Identities = 17/46 (36%), Positives = 21/46 (45%), Gaps = 6/46 (13%) Frame = -2 Query: 24 GPKHKRFPKLSIKYLR------GADPIIKLMDDRGEVQEELSIKKW 63 G H R+P L + R GADP+IK D+G L I W Sbjct: 4661 GHGHCRYPYLHTRRERRRLRDTGADPVIKASCDKGHHHVHLHIATW 4524 >Lt_contig1530 | | 1 to 14591 Length = 14591 Score = 25.4 bits (54), Expect = 6.6 Identities = 15/56 (26%), Positives = 26/56 (46%) Frame = -1 Query: 7 VCACKFGHMPQIEAFVRGPKHKRFPKLSIKYLRGADPIIKLMDDRGEVQEELSIKK 62 VC C++ +P +GP+ K K + Y G + +RGE + + S +K Sbjct: 11366 VCVCEYAPLPASVGRGKGPQVKDANKKGLLYTYGKE------RERGEGESQQSDRK 11217 >Lt_contig1274 | | 1 to 5865 Length = 5865 Score = 25.0 bits (53), Expect = 8.6 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = -1 Query: 47 LMDDRGEVQEELSIKKWDTDTIEE 70 ++DD EV+E SIK+ D+D++ + Sbjct: 1146 IIDDAVEVKESASIKQEDSDSLPD 1075 >Lt_contig6793 | | 1 to 7690 Length = 7690 Score = 25.0 bits (53), Expect = 8.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 6 EVCACKFGHMPQIEAFVRG 24 EVC + GH+P E +RG Sbjct: 5399 EVCVWEEGHLPDAEGLLRG 5455 >Lt_contig3625 | | 1 to 2940 Length = 2940 Score = 25.0 bits (53), Expect = 8.6 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -1 Query: 1 PRAVLEVCACKFGHMPQIEAFVRGPKHK 28 PRA CAC+ H + +G +HK Sbjct: 102 PRARAHACACRGSHTKATASGDKGERHK 19 Database: L.tarentolae/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 31,598,840 Number of sequences in database: 7267 Lambda K H 0.322 0.141 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,249,988 Number of Sequences: 7267 Number of extensions: 41688 Number of successful extensions: 214 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 211 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 214 length of query: 78 length of database: 10,532,946 effective HSP length: 52 effective length of query: 26 effective length of database: 10,155,062 effective search space: 264031612 effective search space used: 264031612 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (25.0 bits)