TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|111494225|ref|NP_579831.2| 15 kDa selenoprotein precursor [Rattus norvegicus] (162 letters) Database: C.fasciculata/genome.fa 1089 sequences; 37,048,325 total letters Searching...................................................done Score E Sequences producing significant alignments: (bits) Value Cf_Contig990 | | 1 to 92272 29 1.5 Cf_Contig893 | | 1 to 117463 29 1.5 Cf_Contig829 | | 1 to 170636 29 1.5 Cf_Contig1042 | | 1 to 246505 29 1.9 Cf_Contig979 | | 1 to 87469 29 1.9 Cf_Contig1047 | | 1 to 300975 27 7.2 Cf_Contig973 | | 1 to 202041 27 9.5 Cf_Contig896 | | 1 to 63591 27 9.5 Cf_Contig876 | | 1 to 197301 27 9.5 >Cf_Contig990 | | 1 to 92272 Length = 92272 Score = 29.3 bits (64), Expect = 1.5 Identities = 17/56 (30%), Positives = 23/56 (41%), Gaps = 6/56 (10%) Frame = -3 Query: 29 LGAEFSSEACRE------LGFSSNLLCSSCDLLGQFNLLPLDPVCRGCCQEEAQFE 78 LGA ++ CR FS++ C + LL LP P C CC + E Sbjct: 7160 LGAALPAQLCRHTRRCSLFSFSASRRCCAVQLLSFSPSLPCCPRCLSCCVNARRIE 6993 >Cf_Contig893 | | 1 to 117463 Length = 117463 Score = 29.3 bits (64), Expect = 1.5 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 19 LATAFQAVSALGAEFSSEACRELGFSSNLLCSS 51 LA +F +++ A FS+ +CR SS C+S Sbjct: 64365 LADSFSLAASVSASFSTSSCRAFSMSSRSCCTS 64267 >Cf_Contig829 | | 1 to 170636 Length = 170636 Score = 29.3 bits (64), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -2 Query: 48 LCSSCDLLGQFNLLPLDPVCRGCCQEEAQ 76 LC C G F+ LP PVC CC ++ Sbjct: 55462 LCRRCAAAG-FSCLPTSPVCAACCSARSR 55379 >Cf_Contig1042 | | 1 to 246505 Length = 246505 Score = 28.9 bits (63), Expect = 1.9 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = -3 Query: 20 ATAFQAVSALGAEFSSEACRELGFSSNLLCSSCDLLGQFNLLPLDPVCRGCC 71 ATA A +A A +S A S + CSSC + N + P+ CC Sbjct: 113915 ATAAAAAAAAAASAASSAYDASRKDSMMSCSSCSPIRSSNGVTAAPLSASCC 113760 >Cf_Contig979 | | 1 to 87469 Length = 87469 Score = 28.9 bits (63), Expect = 1.9 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 6/65 (9%) Frame = -3 Query: 67 CRGCCQEEAQFETKKLYAGAILEVCGXK---LGRFPQVQAFVRSDKP---KLFRGLQIKY 120 C CQ+ A FET+K E C + P + RS++P LF+G IK Sbjct: 38363 CTRVCQDRAAFETRKRNKNRNNETCSCSVFVMPSSPDEKEVGRSEEPSVSSLFQGN*IKA 38184 Query: 121 VRGSD 125 +R D Sbjct: 38183 LRCGD 38169 >Cf_Contig1047 | | 1 to 300975 Length = 300975 Score = 26.9 bits (58), Expect = 7.2 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +1 Query: 36 EACRELGFSSNLLCSSC 52 EAC+E N+LCSSC Sbjct: 133402 EACQERATDGNILCSSC 133452 >Cf_Contig973 | | 1 to 202041 Length = 202041 Score = 26.6 bits (57), Expect = 9.5 Identities = 14/43 (32%), Positives = 18/43 (41%) Frame = +2 Query: 38 CRELGFSSNLLCSSCDLLGQFNLLPLDPVCRGCCQEEAQFETK 80 CR L S +L L GQ + L CR CC E + + Sbjct: 38906 CRPLHLSQHLRSCGEHLAGQRDGLSFPASCRPCCGREGKLRVE 39034 >Cf_Contig896 | | 1 to 63591 Length = 63591 Score = 26.6 bits (57), Expect = 9.5 Identities = 16/54 (29%), Positives = 22/54 (40%) Frame = +1 Query: 27 SALGAEFSSEACRELGFSSNLLCSSCDLLGQFNLLPLDPVCRGCCQEEAQFETK 80 +A+ A ACR L S +L L G + L CR CC E + + Sbjct: 62755 AAMAAVGGCPACRPLHLSQHLRSCGEHLAGLRDGLSFPGSCRPCCGREGKLRVE 62916 >Cf_Contig876 | | 1 to 197301 Length = 197301 Score = 26.6 bits (57), Expect = 9.5 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 54 LLGQFNLLPLDPVCRGCCQEEAQFETKKLY 83 LL F+ LPL P+ RG C A+ + +Y Sbjct: 160330 LLFSFSFLPLQPILRGVCVLPARGSS*NMY 160419 Database: C.fasciculata/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 37,048,325 Number of sequences in database: 1089 Lambda K H 0.322 0.139 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,384,279 Number of Sequences: 1089 Number of extensions: 143708 Number of successful extensions: 732 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 99 Number of HSP's successfully gapped in prelim test: 27 Number of HSP's that attempted gapping in prelim test: 572 Number of HSP's gapped (non-prelim): 274 length of query: 162 length of database: 12,349,441 effective HSP length: 93 effective length of query: 69 effective length of database: 12,248,164 effective search space: 845123316 effective search space used: 845123316 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 57 (26.6 bits)