TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= seed7.SEP15_RAT/84-161 (78 letters) Database: D.discoideum_AX4/genome.fa 6 sequences; 33,943,072 total letters Searching......done Score E Sequences producing significant alignments: (bits) Value gi|93569080|gb|CM000153.2| Dictyostelium discoideum AX4 chromoso... 27 3.2 gi|93569058|gb|CM000155.2| Dictyostelium discoideum AX4 chromoso... 26 5.4 >gi|93569080|gb|CM000153.2| Dictyostelium discoideum AX4 chromosome 4, whole genome shotgun sequence Length = 5450249 Score = 26.6 bits (57), Expect = 3.2 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 8/51 (15%) Frame = -3 Query: 36 KYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVE--------EFLSEKLER 78 K + GSD VL + +N N E+L ILK + D EF+++ L++ Sbjct: 4880832 KPIIGSDDVLYIQLNNENFDEKLEILKNSRDETNSICLNDGLEFINDDLQK 4880680 Score = 25.8 bits (55), Expect = 5.4 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 30 FRGLQIKYVRGSDPVLKLLDDNGN 53 F G+ I+Y P+L L + NGN Sbjct: 2635901 FIGINIRYYEAVSPILDLTNGNGN 2635830 >gi|93569058|gb|CM000155.2| Dictyostelium discoideum AX4 chromosome 6, whole genome shotgun sequence Length = 3602379 Score = 25.8 bits (55), Expect = 5.4 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 3/42 (7%) Frame = -1 Query: 34 QIKYVRGSDPVLKLLDDNGNIAEELSILKW---NTDSVEEFL 72 Q+K R D +LKL+ ++ +S+L W N+ S+E F+ Sbjct: 3284637 QLKLTRFKDGLLKLISNSITKENAISLLLWSKNNSYSLERFI 3284512 Score = 25.4 bits (54), Expect = 7.1 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Frame = +3 Query: 45 LKLLDDNGNIAEELSILKWNTDSVEE---FLSEKLE 77 L+LL+D N +EEL L + VEE LSEK++ Sbjct: 3170019 LELLNDKQNNSEELLNLSYKIKKVEEERDRLSEKID 3170126 Database: D.discoideum_AX4/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 33,943,072 Number of sequences in database: 6 Lambda K H 0.318 0.139 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,879,932 Number of Sequences: 6 Number of extensions: 14933 Number of successful extensions: 64 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 54 Number of HSP's gapped (non-prelim): 20 length of query: 78 length of database: 11,314,357 effective HSP length: 53 effective length of query: 25 effective length of database: 11,314,039 effective search space: 282850975 effective search space used: 282850975 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)