TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|125528691|gb|EAY76805.1| hypothetical protein OsI_04763 [Oryza sativa Indica Group] (162 letters) Database: S.arctica/genome.fa 15,618 sequences; 121,588,341 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value supercont1.35 of Sphaeroforma arctica JP610 29 5.4 supercont1.1556 of Sphaeroforma arctica JP610 28 7.1 supercont1.2489 of Sphaeroforma arctica JP610 28 9.3 >supercont1.35 of Sphaeroforma arctica JP610 Length = 209558 Score = 28.9 bits (63), Expect = 5.4 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 5/44 (11%) Frame = -1 Query: 38 FTGLALCS-----DCNALAEFVKEQELVEDCRKCCTEDSDDSIS 76 F G+ C DC +F+ Q L+++ K C ED+ DS+S Sbjct: 34946 FGGVLSCGARCTFDCGQFYKFILFQFLLDELGKRCREDTKDSLS 34815 >supercont1.1556 of Sphaeroforma arctica JP610 Length = 13650 Score = 28.5 bits (62), Expect = 7.1 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +3 Query: 8 AAAVALVLTSCSVLCLGAERFGARECEELGFTGLA 42 + +A+VL C V ERF A C + +TGLA Sbjct: 13140 SVVIAVVLYKCYVHSRPKERFWAWMCSSVSYTGLA 13244 >supercont1.2489 of Sphaeroforma arctica JP610 Length = 6270 Score = 28.1 bits (61), Expect = 9.3 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -1 Query: 5 VYVAAAVALVLTSCSVLCLGAERFGARECEELGFTGL 41 +YV A+V + L++C +C+ R + C E TG+ Sbjct: 5886 IYVWASVLVCLSACVCVCVSHIRSHKQTCRETPITGI 5776 Database: S.arctica/genome.fa Posted date: Nov 21, 2011 7:47 PM Number of letters in database: 121,588,341 Number of sequences in database: 15,618 Lambda K H 0.321 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,122,210 Number of Sequences: 15618 Number of extensions: 497639 Number of successful extensions: 1712 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1041 Number of HSP's successfully gapped in prelim test: 44 Number of HSP's that attempted gapping in prelim test: 526 Number of HSP's gapped (non-prelim): 1319 length of query: 162 length of database: 40,529,447 effective HSP length: 100 effective length of query: 62 effective length of database: 38,967,647 effective search space: 2415994114 effective search space used: 2415994114 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 61 (28.1 bits)