TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= seed6.A2WXV9_ORYSI/81-157 (77 letters) Database: C.fasciculata/genome.fa 1089 sequences; 37,048,325 total letters Searching...................................................done Score E Sequences producing significant alignments: (bits) Value Cf_Contig791 | | 1 to 34061 28 1.5 Cf_Contig675 | | 1 to 73122 28 1.5 Cf_Contig946 | | 1 to 179534 27 3.4 Cf_Contig1072 | | 1 to 216731 26 5.9 Cf_Contig743 | | 1 to 77010 25 7.7 >Cf_Contig791 | | 1 to 34061 Length = 34061 Score = 27.7 bits (60), Expect = 1.5 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +2 Query: 45 IMLDDKGDQKETIRIDNWKREHIRQF 70 ++ DD +KE +R + W R H+R++ Sbjct: 32258 VLCDDLLQEKEKVRTERWSRLHLRRW 32335 >Cf_Contig675 | | 1 to 73122 Length = 73122 Score = 27.7 bits (60), Expect = 1.5 Identities = 18/38 (47%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Frame = -2 Query: 3 AIIEVCMRK-LVFYPEIVGFLEEDKDD--FPYVEARYV 37 AI E+C+ L+F+ EIV F E DKD F E R V Sbjct: 14015 AIWEICVSSSLIFHLEIVSFTELDKDGMIFDLFETRNV 13902 >Cf_Contig946 | | 1 to 179534 Length = 179534 Score = 26.6 bits (57), Expect = 3.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 5 IEVCMRKLVFYPEIVGFL 22 + VC R FYP ++GFL Sbjct: 24585 VRVCARVCAFYPRVLGFL 24532 >Cf_Contig1072 | | 1 to 216731 Length = 216731 Score = 25.8 bits (55), Expect = 5.9 Identities = 9/26 (34%), Positives = 19/26 (73%) Frame = -3 Query: 39 GSPPKLIMLDDKGDQKETIRIDNWKR 64 G+ P+ ++ KG+++ T+R D+W+R Sbjct: 65892 GNGPRHRVVTVKGERRGTVRRDHWRR 65815 >Cf_Contig743 | | 1 to 77010 Length = 77010 Score = 25.4 bits (54), Expect = 7.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 33 EARYVYGSPPKLIM 46 E RYVYG+PPK ++ Sbjct: 76684 EPRYVYGAPPKSML 76643 Database: C.fasciculata/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 37,048,325 Number of sequences in database: 1089 Lambda K H 0.321 0.144 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,685,528 Number of Sequences: 1089 Number of extensions: 40386 Number of successful extensions: 146 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 91 Number of HSP's gapped (non-prelim): 66 length of query: 77 length of database: 12,349,441 effective HSP length: 52 effective length of query: 25 effective length of database: 12,292,813 effective search space: 307320325 effective search space used: 307320325 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)