TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|71467677|emb|CAI44701.1| selenoprotein M [Suberites domuncula] (123 letters) Database: D.fasciculatum/genome.fa 25 sequences; 31,019,208 total letters Searching.........................done Score E Sequences producing significant alignments: (bits) Value gi|328870595|gb|GL883016.1| Dictyostelium fasciculatum unplaced ... 29 0.64 gi|328876102|gb|GL883006.1| Dictyostelium fasciculatum unplaced ... 28 1.1 gi|328868227|gb|GL883021.1| Dictyostelium fasciculatum unplaced ... 27 2.4 gi|328872098|gb|GL883010.1| Dictyostelium fasciculatum unplaced ... 27 3.2 gi|328864870|gb|GL883029.1| Dictyostelium fasciculatum unplaced ... 27 4.2 gi|328866594|gb|GL883026.1| Dictyostelium fasciculatum unplaced ... 26 5.4 gi|328869808|gb|GL883018.1| Dictyostelium fasciculatum unplaced ... 26 5.4 gi|328866373|gb|GL883027.1| Dictyostelium fasciculatum unplaced ... 25 9.3 >gi|328870595|gb|GL883016.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-G-b-143d02.r1-5, whole genome shotgun sequence Length = 656888 Score = 29.3 bits (64), Expect = 0.64 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = +1 Query: 72 EYQEVTRVSVIKMSEQEIIDLLASHNIVKRSPEEAEAEEDTEPWEQDEREEL 123 +YQ+ T ++ I + Q I+ L + + RSP+ E + W D +EL Sbjct: 585331 DYQDATAMNQIATNYQNYINQLVTSSGGSRSPDSNENRKKASQWIYDYLQEL 585486 Score = 25.8 bits (55), Expect = 7.1 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +2 Query: 102 SPEEAEAEEDTEPWEQDEREE 122 S +E + EED E E+DE EE Sbjct: 513794 SDDEEDVEEDEEEVEEDEEEE 513856 Score = 25.4 bits (54), Expect = 9.3 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 99 VKRSPEEAEAEEDTEPWEQDEREE 122 VK ++ + EED E W E+EE Sbjct: 224856 VKDEEKDDDEEEDKEEWPSQEKEE 224927 >gi|328876102|gb|GL883006.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-G-b-205a01.r1-3, whole genome shotgun sequence Length = 2485436 Score = 28.5 bits (62), Expect = 1.1 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Frame = -2 Query: 72 EYQEVTRVSVIKMSEQEIIDLLASHNIVKRSPEEAE---AEEDTEPWEQDEREE 122 E QEV + + ++E+++ V++ PEE E EE+ EQ + EE Sbjct: 2371711 EEQEVVAATTEEEKQEEVVEQQEEEPKVEQEPEEVEETKQEEEVAAVEQQQEEE 2371550 Score = 26.9 bits (58), Expect = 3.2 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +2 Query: 97 NIVKRSPEEAEAEEDTEPWEQDEREEL 123 NIVK+ + +AEED E E++E + L Sbjct: 1009118 NIVKKDEKVEQAEEDDEEEEEEEEQYL 1009198 Score = 25.8 bits (55), Expect = 7.1 Identities = 20/53 (37%), Positives = 28/53 (52%) Frame = +1 Query: 69 MDAEYQEVTRVSVIKMSEQEIIDLLASHNIVKRSPEEAEAEEDTEPWEQDERE 121 +D E +EV V K ++ D S N K+S +E E EED E E+D+ E Sbjct: 1139710 VDEEEEEVIPQPVKKCGKK---DKKKSSN-KKQSEDEDEEEEDDEEIEEDDDE 1139856 Score = 25.4 bits (54), Expect = 9.3 Identities = 8/30 (26%), Positives = 20/30 (66%) Frame = +2 Query: 93 LASHNIVKRSPEEAEAEEDTEPWEQDEREE 122 LASH+++KR E+ ++ + +Q ++++ Sbjct: 53240 LASHDLIKRQKEKLALQQQQQQQQQQQQQQ 53329 Score = 25.4 bits (54), Expect = 9.3 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 97 NIVKRSPEEAEAEEDTEPWEQDE 119 NIVKRS E EE+ E E+ E Sbjct: 166624 NIVKRSKEHIHLEEEVEEVEEKE 166556 >gi|328868227|gb|GL883021.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_ET2XIPL01COFD4-5, whole genome shotgun sequence Length = 3468650 Score = 27.3 bits (59), Expect = 2.4 Identities = 14/54 (25%), Positives = 31/54 (57%) Frame = -2 Query: 68 LMDAEYQEVTRVSVIKMSEQEIIDLLASHNIVKRSPEEAEAEEDTEPWEQDERE 121 + + E Q+ T+ +++ ++E++ ++V+ + +E EED E E+DE E Sbjct: 2294743 IQEDEPQKKTQSNIMTLNEED-----KDESMVESTKDEEMGEEDEEMVEEDEEE 2294597 Score = 26.9 bits (58), Expect = 3.2 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = +1 Query: 8 LTLCVSLAIGV--GEIKKARLESCSGXRLNSLPKVKRFINDHLPDYPDLEIKYI 59 L LCV + V G ++ A+ +CS K K+ +ND + ++EIKYI Sbjct: 1334983 LILCVEILFQVTEGRVRSAQ*GTCS-----IFFKKKKVVNDQKTNKIEIEIKYI 1335129 >gi|328872098|gb|GL883010.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-F-a-25c12.r2-5, whole genome shotgun sequence Length = 4166812 Score = 26.9 bits (58), Expect = 3.2 Identities = 11/36 (30%), Positives = 24/36 (66%) Frame = -1 Query: 83 KMSEQEIIDLLASHNIVKRSPEEAEAEEDTEPWEQD 118 K+ + D + SH++++RS E+++E+D + EQ+ Sbjct: 1747924 KLKAIGLTDSVHSHSVLRRSNVESDSEDDDDDNEQN 1747817 >gi|328864870|gb|GL883029.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_EUAJFUG02HR96I-5, whole genome shotgun sequence Length = 3408800 Score = 26.6 bits (57), Expect = 4.2 Identities = 14/53 (26%), Positives = 26/53 (49%) Frame = -1 Query: 70 DAEYQEVTRVSVIKMSEQEIIDLLASHNIVKRSPEEAEAEEDTEPWEQDEREE 122 D + +E T + K E+E D+ + EE + E+D + ++DE +E Sbjct: 1273442 DFDKEESTAATEEKDEEEEEEDIEKEEEEEEEEEEEEDDEDDEDDEDEDEEDE 1273284 Score = 25.4 bits (54), Expect = 9.3 Identities = 10/23 (43%), Positives = 18/23 (78%) Frame = +2 Query: 33 RLNSLPKVKRFINDHLPDYPDLE 55 +++++PK+KR I D +PD P +E Sbjct: 3138206 KVSTVPKLKRRIADPVPDVPLVE 3138274 >gi|328866594|gb|GL883026.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_EU5ZYIE02H8LDV-5, whole genome shotgun sequence Length = 1919465 Score = 26.2 bits (56), Expect = 5.4 Identities = 21/78 (26%), Positives = 37/78 (47%) Frame = -2 Query: 16 IGVGEIKKARLESCSGXRLNSLPKVKRFINDHLPDYPDLEIKYIGGADPVMVLMDAEYQE 75 + G+++KA+ R S PK +R N LE+ ++ D + LMD + E Sbjct: 1661176 MAAGQLEKAQAFIDKAKR--SSPKSERVQN------AQLELSHLVEVDKINKLMDNAFGE 1661021 Query: 76 VTRVSVIKMSEQEIIDLL 93 +R ++ +EII L+ Sbjct: 1661020 FSR*PKVEKKRKEIIILI 1660967 Score = 25.4 bits (54), Expect = 9.3 Identities = 20/84 (23%), Positives = 35/84 (41%) Frame = +1 Query: 38 PKVKRFINDHLPDYPDLEIKYIGGADPVMVLMDAEYQEVTRVSVIKMSEQEIIDLLASHN 97 P + F+ ++ +Y DLE D EY+E+ + E++ D Sbjct: 474679 PPKREFMKWYVKNYNDLEDG------------DEEYEEIDYDQDVYEEEEQEED------ 474804 Query: 98 IVKRSPEEAEAEEDTEPWEQDERE 121 + +E E +ED E ++DE E Sbjct: 474805 ---KDEDEEEIDEDEEEIDEDEEE 474867 >gi|328869808|gb|GL883018.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-G-b-285a01.f1-5, whole genome shotgun sequence Length = 1327167 Score = 26.2 bits (56), Expect = 5.4 Identities = 14/45 (31%), Positives = 26/45 (57%) Frame = -3 Query: 78 RVSVIKMSEQEIIDLLASHNIVKRSPEEAEAEEDTEPWEQDEREE 122 R + ++++ ++ID L + K P +AE+D E E+DE E+ Sbjct: 583990 REQLQRLTKDQLIDRL----VEKAFPINVDAEDDEEDDEEDEDED 583868 >gi|328866373|gb|GL883027.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_EUAJFUG01CK1KI-5, whole genome shotgun sequence Length = 542435 Score = 25.4 bits (54), Expect = 9.3 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = -1 Query: 100 KRSPEEAEAEEDTEPWEQDEREEL 123 +++ EE E EED E ++++REE+ Sbjct: 331625 EKNEEENEDEEDEEEKDREDREEI 331554 Database: D.fasciculatum/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 31,019,208 Number of sequences in database: 25 Lambda K H 0.315 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,264,609 Number of Sequences: 25 Number of extensions: 34499 Number of successful extensions: 179 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 142 Number of HSP's gapped (non-prelim): 91 length of query: 123 length of database: 10,339,736 effective HSP length: 87 effective length of query: 36 effective length of database: 10,337,561 effective search space: 372152196 effective search space used: 372152196 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 54 (25.4 bits)