TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|71467677|emb|CAI44701.1| selenoprotein M [Suberites domuncula] (123 letters) Database: C.fasciculata/genome.fa 1089 sequences; 37,048,325 total letters Searching...................................................done Score E Sequences producing significant alignments: (bits) Value Cf_Contig1020 | | 1 to 153148 27 2.8 Cf_Contig866 | | 1 to 136535 27 2.8 Cf_Contig1015 | | 1 to 112272 26 6.3 Cf_Contig876 | | 1 to 197301 26 6.3 >Cf_Contig1020 | | 1 to 153148 Length = 153148 Score = 27.3 bits (59), Expect = 2.8 Identities = 19/77 (24%), Positives = 32/77 (41%) Frame = -1 Query: 45 NDHLPDYPDLEIKYIGGADPVMVLMDAEYQEVTRVSVIKMSEQEIIDLLASHNIVKRSPE 104 N H + P+ E++ G + + + +RV + I LLA K+ E Sbjct: 132091 NGHSQERPEREVESEGQHRGIQTHTYTQKKNASRVESPASLKIRIATLLARSE--KKKIE 131918 Query: 105 EAEAEEDTEPWEQDERE 121 + E + PW + ERE Sbjct: 131917 YKKGERKSAPWREGERE 131867 >Cf_Contig866 | | 1 to 136535 Length = 136535 Score = 27.3 bits (59), Expect = 2.8 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 8/48 (16%) Frame = +2 Query: 10 LCVSLAIGVGEIKKARLESCSG--------XRLNSLPKVKRFINDHLP 49 LC +GVG + +L+SC G N +P + ++ HLP Sbjct: 78863 LCARCCVGVGSSRWEQLQSCVGTVEKYWKELY*NEMPVMVMYVTKHLP 79006 >Cf_Contig1015 | | 1 to 112272 Length = 112272 Score = 26.2 bits (56), Expect = 6.3 Identities = 28/120 (23%), Positives = 49/120 (40%), Gaps = 6/120 (5%) Frame = -1 Query: 10 LCVSLAIGVGEIKKARLESCSGXRLNSLPKVKRFINDHLPDYPDLEIKYIGGADPVMVLM 69 +C++ ++G+ E + E C G V F+ +HL D P ++ + Sbjct: 24402 VCMARSLGIHESQSRFQEVCIGRSGAFAEFVTPFLKEHLGDQPAFTVEN----------L 24253 Query: 70 DAEYQEVTRVSVIKMSEQEIIDLLASHNIVKRSPEEA------EAEEDTEPWEQDEREEL 123 YQ V + I++ E+ L H I++ E A EAE+ W + +E L Sbjct: 24252 RKTYQRV-KPGYIRIYADEVCYPL--HVIMRYEMERALIEGKLEAEDIPRVWNEKMKEYL 24082 >Cf_Contig876 | | 1 to 197301 Length = 197301 Score = 26.2 bits (56), Expect = 6.3 Identities = 23/89 (25%), Positives = 42/89 (47%), Gaps = 5/89 (5%) Frame = -1 Query: 39 KVKRFINDHLPDYPDL--EIKYIGGADPVMVLMDAEYQEVTRVSVIKMSEQE---IIDLL 93 KV + P DL E K++ + LM+ + + ++K EQ+ + +L Sbjct: 172008 KVVTLPGESAPSELDLYNERKWLNAVEATC-LMEQRARMDECMDILKAVEQDHSNVRSVL 171832 Query: 94 ASHNIVKRSPEEAEAEEDTEPWEQDEREE 122 +S++ ++ P+E EAE + E REE Sbjct: 171831 SSYDTLRNRPKETEAERARKLAEAVRREE 171745 Database: C.fasciculata/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 37,048,325 Number of sequences in database: 1089 Lambda K H 0.315 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,472,952 Number of Sequences: 1089 Number of extensions: 49366 Number of successful extensions: 209 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 62 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 134 Number of HSP's gapped (non-prelim): 105 length of query: 123 length of database: 12,349,441 effective HSP length: 88 effective length of query: 35 effective length of database: 12,253,609 effective search space: 428876315 effective search space used: 428876315 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 54 (25.4 bits)