TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= seed5.Q4A3I8_SUBDO/23-99 (77 letters) Database: D.discoideum_AX4/genome.fa 6 sequences; 33,943,072 total letters Searching......done Score E Sequences producing significant alignments: (bits) Value gi|93569114|gb|CM000150.2| Dictyostelium discoideum AX4 chromoso... 39 8e-04 gi|93569092|gb|CM000152.2| Dictyostelium discoideum AX4 chromoso... 27 1.9 gi|256541943|gb|CM000151.3| Dictyostelium discoideum AX4 chromos... 25 9.2 >gi|93569114|gb|CM000150.2| Dictyostelium discoideum AX4 chromosome 1, whole genome shotgun sequence Length = 4923596 Score = 38.5 bits (88), Expect = 8e-04 Identities = 17/40 (42%), Positives = 26/40 (65%) Frame = -1 Query: 11 RLNSLPKVKRFINDHLPDYPDLEIKYIGGADPVMVLMDAE 50 RL + P++K FIN+ Y L +KY GA+P + L+D+E Sbjct: 1140053 RLGAHPQIKEFINNKAKLYSKLSVKYENGANPRLTLVDSE 1139934 >gi|93569092|gb|CM000152.2| Dictyostelium discoideum AX4 chromosome 3, whole genome shotgun sequence Length = 6357299 Score = 27.3 bits (59), Expect = 1.9 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +3 Query: 23 NDHLPDYPDLEIKYIGGADPVMVL 46 ND L YP+L++ ++GG P+ +L Sbjct: 1742610 ND*LK*YPNLKVSHVGGITPLSIL 1742681 Score = 25.0 bits (53), Expect = 9.2 Identities = 15/55 (27%), Positives = 26/55 (47%) Frame = -2 Query: 19 KRFINDHLPDYPDLEIKYIGGADPVMVLMDAEYQEVTRVSVIKMSEQEIIDLLAS 73 ++ IN + YP+LEI D ++V + E+ +S I + LL+S Sbjct: 654268 RKGINKYSNSYPNLEISCFNSEDSIVV--SGDENELKSLSTILQNNNIFSSLLSS 654110 >gi|256541943|gb|CM000151.3| Dictyostelium discoideum AX4 chromosome 2, whole genome shotgun sequence Length = 8484197 Score = 25.0 bits (53), Expect = 9.2 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +1 Query: 12 LNSLPKVKRFINDHLPDYPDLEIKYI 37 LN + +F+N HL + L+IKY+ Sbjct: 6459199 LNFYEDIVKFLNYHLKKHDQLQIKYM 6459276 Database: D.discoideum_AX4/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 33,943,072 Number of sequences in database: 6 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,002,144 Number of Sequences: 6 Number of extensions: 15374 Number of successful extensions: 62 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 56 Number of HSP's gapped (non-prelim): 22 length of query: 77 length of database: 11,314,357 effective HSP length: 52 effective length of query: 25 effective length of database: 11,314,045 effective search space: 282851125 effective search space used: 282851125 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)