TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= seed4.Q4PMN9_IXOSC/30-106 (77 letters) Database: L.tarentolae/genome.fa 7267 sequences; 31,598,840 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Lt_contig5025 | | 1 to 6507 28 0.78 Lt_contig4310 | | 1 to 1849 26 5.0 Lt_contig687 | | 1 to 2703 26 5.0 Lt_contig5222 | | 1 to 7105 25 6.6 Lt_contig540 | | 1 to 29965 25 8.6 >Lt_contig5025 | | 1 to 6507 Length = 6507 Score = 28.5 bits (62), Expect = 0.78 Identities = 12/34 (35%), Positives = 23/34 (67%) Frame = -2 Query: 37 IGGAKPEVLFLNMNDEEVERHSLEGRSRDECNQL 70 + GA+ ++L+L +D+E HSL G + D+ ++L Sbjct: 2822 VRGARSDLLYLVHDDDEALFHSLSGSAGDQLSRL 2721 >Lt_contig4310 | | 1 to 1849 Length = 1849 Score = 25.8 bits (55), Expect = 5.0 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 3 RVESCGGXRLNAYPEVKKFVY 23 R CGG R YP + FVY Sbjct: 154 RARVCGGGRERTYPRTQVFVY 216 >Lt_contig687 | | 1 to 2703 Length = 2703 Score = 25.8 bits (55), Expect = 5.0 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 6/66 (9%) Frame = +2 Query: 11 RLNAYPE------VKKFVYDDIPLFHNVEFKVIGGAKPEVLFLNMNDEEVERHSLEGRSR 64 RLNA PE ++ V D + L +GGA +++ VERHS++ R+ Sbjct: 2039 RLNALPEEGMIEVLRSVVVDALQLR-------VGGA--------FHNQLVERHSIQWRAL 2173 Query: 65 DECNQL 70 DE QL Sbjct: 2174 DELVQL 2191 >Lt_contig5222 | | 1 to 7105 Length = 7105 Score = 25.4 bits (54), Expect = 6.6 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 44 VLFLNMNDEEVERHSLEGRSRDECNQLLL 72 VLF N+E RH EG+ D CN+ L Sbjct: 2852 VLFRRTNEE---RHCSEGQHLDRCNETAL 2929 >Lt_contig540 | | 1 to 29965 Length = 29965 Score = 25.0 bits (53), Expect = 8.6 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -3 Query: 26 IPLFHNVEFKVIGGAKPEVLFLNMNDEEVERHSLEGR 62 IP ++ + I + ++LF DE VER EGR Sbjct: 17150 IPYAFFIDGEQINSSVQDILFRRQKDEYVERMLKEGR 17040 Database: L.tarentolae/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 31,598,840 Number of sequences in database: 7267 Lambda K H 0.320 0.141 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,898,123 Number of Sequences: 7267 Number of extensions: 28900 Number of successful extensions: 85 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 85 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 85 length of query: 77 length of database: 10,532,946 effective HSP length: 51 effective length of query: 26 effective length of database: 10,162,329 effective search space: 264220554 effective search space used: 264220554 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)