TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= seed3.A5J2A1_LITVA/31-107 (77 letters) Database: P.capsici/genome.fa 917 sequences; 64,023,748 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value PHYCAscaffold_31 28 2.7 PHYCAscaffold_57 27 6.0 PHYCAscaffold_7 27 6.0 PHYCAscaffold_327 26 7.8 PHYCAscaffold_19 26 7.8 PHYCAscaffold_13 26 7.8 >PHYCAscaffold_31 Length = 686815 Score = 27.7 bits (60), Expect = 2.7 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +3 Query: 28 LFHNAKFKQIGGAPPELVLLNRFDQVVERLPL 59 LFH+ K IGG P L+ L RF ++ + P+ Sbjct: 431070 LFHDKKRA*IGGKPSSLLSLERFTKLRDGTPM 431165 >PHYCAscaffold_57 Length = 397303 Score = 26.6 bits (57), Expect = 6.0 Identities = 19/47 (40%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = -2 Query: 11 RLNRLPE-VKKFIHEDIPLFHNAKFKQIGGAPPELVLLNRFDQVVER 56 R NR VK+ I LFH+ K IGG P L+ L R Q R Sbjct: 71274 RKNRFSHPVKRCIFLSPQLFHDKKRA*IGGKPSCLLSLERLHQTPRR 71134 >PHYCAscaffold_7 Length = 1368812 Score = 26.6 bits (57), Expect = 6.0 Identities = 15/43 (34%), Positives = 25/43 (58%) Frame = -2 Query: 5 ESCGGXRLNRLPEVKKFIHEDIPLFHNAKFKQIGGAPPELVLL 47 + GG R ++ ++++ I ++PL H FK +G PP VLL Sbjct: 133852 DDIGGCR-RQMAQIREMI--ELPLRHPQLFKTLGVKPPRGVLL 133733 >PHYCAscaffold_327 Length = 8127 Score = 26.2 bits (56), Expect = 7.8 Identities = 11/37 (29%), Positives = 22/37 (59%), Gaps = 4/37 (10%) Frame = -2 Query: 2 ARVESCG----GXRLNRLPEVKKFIHEDIPLFHNAKF 34 A+ +S G G R++ +P +F+H + +FH ++F Sbjct: 7472 AQTDSSGNCTNGRRISNVPITLRFMHNILSIFHQSEF 7362 >PHYCAscaffold_19 Length = 944885 Score = 26.2 bits (56), Expect = 7.8 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +3 Query: 13 NRLPEVKKFIHEDIPLFHNAKFKQIGGAPPEL-VLLNRFDQVVERLPLD 60 NRL E K + +D HN + QIG PE L+ R +V +L +D Sbjct: 372336 NRLDEWLKNLGDDKTPLHNEEELQIGVEEPEARELVKRLLRVYRKLTMD 372482 >PHYCAscaffold_13 Length = 1060349 Score = 26.2 bits (56), Expect = 7.8 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = -3 Query: 13 NRLPEVKKFIHEDIPLFHNAKFKQIGGAPPEL-VLLNRFDQVVERLPLD 60 NRL E K + +D HN + QIG PE L+ R +V +L +D Sbjct: 953733 NRLDEWLKNLGDDKTPLHNEEELQIGVEEPEARELVKRLLRVYRKLTMD 953587 Database: P.capsici/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 64,023,748 Number of sequences in database: 917 Lambda K H 0.323 0.144 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,780,156 Number of Sequences: 917 Number of extensions: 64917 Number of successful extensions: 250 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 15 Number of HSP's that attempted gapping in prelim test: 198 Number of HSP's gapped (non-prelim): 104 length of query: 77 length of database: 21,341,249 effective HSP length: 52 effective length of query: 25 effective length of database: 21,293,565 effective search space: 532339125 effective search space used: 532339125 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 55 (25.8 bits)