TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= seed3.A5J2A1_LITVA/31-107 (77 letters) Database: L.tarentolae/genome.fa 7267 sequences; 31,598,840 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Lt_contig4872 | | 1 to 5893 28 1.3 Lt_contig1377 | | 1 to 11472 28 1.3 Lt_contig5987 | | 1 to 11060 25 8.6 Lt_contig5121 | | 1 to 7726 25 8.6 Lt_contig7265 | | 1 to 10690 25 8.6 >Lt_contig4872 | | 1 to 5893 Length = 5893 Score = 27.7 bits (60), Expect = 1.3 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 11 RLNRLPEVKKFIHEDIPLFHNAKFKQI 37 RL LPE ++ IHED+ +H +Q+ Sbjct: 2884 RLKALPEDEQMIHEDVTEYHLVSRRQV 2964 >Lt_contig1377 | | 1 to 11472 Length = 11472 Score = 27.7 bits (60), Expect = 1.3 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 11 RLNRLPEVKKFIHEDIPLFHNAKFKQI 37 RL LPE ++ IHED+ +H +Q+ Sbjct: 8463 RLKALPEDEQMIHEDVTEYHLVSRRQV 8543 >Lt_contig5987 | | 1 to 11060 Length = 11060 Score = 25.0 bits (53), Expect = 8.6 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -3 Query: 25 DIPLFHNAKFKQIGGAPPELVLL 47 ++P+ H K+ Q+G PP+ VLL Sbjct: 1437 ELPITHPEKYTQLGIDPPKGVLL 1369 >Lt_contig5121 | | 1 to 7726 Length = 7726 Score = 25.0 bits (53), Expect = 8.6 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -2 Query: 28 LFHNAKFKQIGGAPPE-LVLLNRFDQVVERLPLDKLS 63 L H K IGGAPPE L R D V L + K S Sbjct: 3780 LMHIVLDKAIGGAPPE*FSELTRADSVSRHL*MTKKS 3670 >Lt_contig7265 | | 1 to 10690 Length = 10690 Score = 25.0 bits (53), Expect = 8.6 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 3 RVESCGGXRLNRLPEVKKFIHEDIP 27 R C G RL + V+ F+H+D P Sbjct: 4453 RFVRCSGLRLCNVLVVRPFVHQDYP 4379 Database: L.tarentolae/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 31,598,840 Number of sequences in database: 7267 Lambda K H 0.323 0.144 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,473,943 Number of Sequences: 7267 Number of extensions: 42512 Number of successful extensions: 111 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 111 length of query: 77 length of database: 10,532,946 effective HSP length: 51 effective length of query: 26 effective length of database: 10,162,329 effective search space: 264220554 effective search space used: 264220554 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (25.0 bits)