TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= seed3.A5J2A1_LITVA/31-107 (77 letters) Database: D.fasciculatum/genome.fa 25 sequences; 31,019,208 total letters Searching.........................done Score E Sequences producing significant alignments: (bits) Value gi|328870360|gb|GL883017.1| Dictyostelium fasciculatum unplaced ... 28 1.3 gi|328872098|gb|GL883010.1| Dictyostelium fasciculatum unplaced ... 27 2.9 gi|328868039|gb|GL883023.1| Dictyostelium fasciculatum unplaced ... 26 4.9 gi|328876102|gb|GL883006.1| Dictyostelium fasciculatum unplaced ... 25 6.4 >gi|328870360|gb|GL883017.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-G-b-190b03.r1-5, whole genome shotgun sequence Length = 548609 Score = 27.7 bits (60), Expect = 1.3 Identities = 15/43 (34%), Positives = 26/43 (60%) Frame = -2 Query: 5 ESCGGXRLNRLPEVKKFIHEDIPLFHNAKFKQIGGAPPELVLL 47 + GG R +L ++++ + ++PL H FK IG PP+ +LL Sbjct: 149959 DDIGGVR-KQLGQIRELV--ELPLRHPQLFKNIGVKPPKGILL 149840 >gi|328872098|gb|GL883010.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-F-a-25c12.r2-5, whole genome shotgun sequence Length = 4166812 Score = 26.6 bits (57), Expect = 2.9 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -2 Query: 25 DIPLFHNAKFKQIGGAPPELVLL 47 ++PL H+ +KQIG PP VLL Sbjct: 2910627 ELPLTHHNLYKQIGIDPPRGVLL 2910559 >gi|328868039|gb|GL883023.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_EU5ZYIE01BBABR-5, whole genome shotgun sequence Length = 470708 Score = 25.8 bits (55), Expect = 4.9 Identities = 13/39 (33%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = -2 Query: 37 IGGAPPELVLLNRFDQVV--ERLPLDKLSREECNKLMLK 73 +G PP + LLNR++Q V ++P++ + + N L L+ Sbjct: 348715 LGSIPPLVYLLNRYNQKVWLHQMPIEMILLLKMNPLPLQ 348599 >gi|328876102|gb|GL883006.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-G-b-205a01.r1-3, whole genome shotgun sequence Length = 2485436 Score = 25.4 bits (54), Expect = 6.4 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 7 CGGXRLNRLPEVKKFIHEDI 26 CG LNRLP K+ IH I Sbjct: 1740878 CGNVPLNRLPATKRQIHHII 1740937 Database: D.fasciculatum/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 31,019,208 Number of sequences in database: 25 Lambda K H 0.323 0.144 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,465,190 Number of Sequences: 25 Number of extensions: 26717 Number of successful extensions: 102 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 93 Number of HSP's gapped (non-prelim): 22 length of query: 77 length of database: 10,339,736 effective HSP length: 52 effective length of query: 25 effective length of database: 10,338,436 effective search space: 258460900 effective search space used: 258460900 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 52 (24.6 bits)