TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= seed3.A5J2A1_LITVA/31-107 (77 letters) Database: C.fasciculata/genome.fa 1089 sequences; 37,048,325 total letters Searching...................................................done Score E Sequences producing significant alignments: (bits) Value Cf_Contig1069 | | 1 to 371363 27 2.6 Cf_Contig738 | | 1 to 50143 27 3.4 Cf_Contig904 | | 1 to 269533 26 5.9 Cf_Contig1071 | | 1 to 673414 25 7.7 >Cf_Contig1069 | | 1 to 371363 Length = 371363 Score = 26.9 bits (58), Expect = 2.6 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +1 Query: 5 ESCGGXRLNRLPEVKKFIHEDIPLFHNAKFKQIGGAPPELVLL 47 ES G RL RLPE+ +HE H +++G + LL Sbjct: 164671 ESLRGVRLERLPELVLAVHEPRAHLHPCVGQELGADVDVVALL 164799 >Cf_Contig738 | | 1 to 50143 Length = 50143 Score = 26.6 bits (57), Expect = 3.4 Identities = 18/43 (41%), Positives = 22/43 (51%) Frame = +3 Query: 14 RLPEVKKFIHEDIPLFHNAKFKQIGGAPPELVLLNRFDQVVER 56 RL E+KK E P AK+K IG PP+ L R +ER Sbjct: 19863 RLAELKKRREELTPTAE-AKYKTIGPRPPKQRLTKRQKAALER 19988 >Cf_Contig904 | | 1 to 269533 Length = 269533 Score = 25.8 bits (55), Expect = 5.9 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +2 Query: 18 VKKFIHEDIP-LFHNAKFKQIGGAPPELVLLNR 49 V + E IP LF N F+ GGAPP L + R Sbjct: 196460 VSSYFLEAIPFLFLNITFEVRGGAPPSLNVAQR 196558 >Cf_Contig1071 | | 1 to 673414 Length = 673414 Score = 25.4 bits (54), Expect = 7.7 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 39 GAPPELVLLNRFDQVVERLPL 59 G PP +L RF ++ RLPL Sbjct: 5868 GRPPRRAVLKRFCSLIRRLPL 5930 Database: C.fasciculata/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 37,048,325 Number of sequences in database: 1089 Lambda K H 0.323 0.144 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,015,235 Number of Sequences: 1089 Number of extensions: 46459 Number of successful extensions: 133 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 52 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 75 Number of HSP's gapped (non-prelim): 65 length of query: 77 length of database: 12,349,441 effective HSP length: 52 effective length of query: 25 effective length of database: 12,292,813 effective search space: 307320325 effective search space used: 307320325 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (25.0 bits)