TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= seed2.SELM_DANRE/29-105 (77 letters) Database: D.discoideum_AX4/genome.fa 6 sequences; 33,943,072 total letters Searching......done Score E Sequences producing significant alignments: (bits) Value gi|93569080|gb|CM000153.2| Dictyostelium discoideum AX4 chromoso... 29 0.64 gi|93569114|gb|CM000150.2| Dictyostelium discoideum AX4 chromoso... 28 0.83 gi|93569058|gb|CM000155.2| Dictyostelium discoideum AX4 chromoso... 28 1.1 gi|93569092|gb|CM000152.2| Dictyostelium discoideum AX4 chromoso... 27 3.2 gi|256541943|gb|CM000151.3| Dictyostelium discoideum AX4 chromos... 25 7.1 >gi|93569080|gb|CM000153.2| Dictyostelium discoideum AX4 chromosome 4, whole genome shotgun sequence Length = 5450249 Score = 28.9 bits (63), Expect = 0.64 Identities = 8/28 (28%), Positives = 20/28 (71%) Frame = -3 Query: 48 NHYYEELDRIPLSEMTRAEINKLLAELG 75 NHY+ + DR+P++ + A++++ + + G Sbjct: 2612187 NHYFSDFDRLPIAAASLAQVHRAITKEG 2612104 >gi|93569114|gb|CM000150.2| Dictyostelium discoideum AX4 chromosome 1, whole genome shotgun sequence Length = 4923596 Score = 28.5 bits (62), Expect = 0.83 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +2 Query: 42 PELVLLNHYYEELDRIPLSEMTRAEINKLLAELGFY 77 P L+ + +YY LD++ + E A +N+ L +L FY Sbjct: 1615997 PLLLTIINYYYLLDQLNIHEYNEAYLNQPLMKLNFY 1616104 Score = 25.0 bits (53), Expect = 9.2 Identities = 8/31 (25%), Positives = 18/31 (58%) Frame = -3 Query: 20 AFVTQDIPLYHNLVMKHIPGADPELVLLNHY 50 ++V + L HN+++ ++ D +L+ HY Sbjct: 2949327 SYVQNQVELPHNVLIHYVDSQDQSFILV*HY 2949235 Score = 25.0 bits (53), Expect = 9.2 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 19 KAFVTQDIPLYHNLVMKHIPGADPELVLLNHYYEELDRIPL 59 K F+ DI YH + +K A+P+ + + YY + PL Sbjct: 3394123 KDFIVSDI--YHLMGLKDTNTANPKTIKVKEYYYFMSPSPL 3394239 Score = 25.0 bits (53), Expect = 9.2 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = +1 Query: 33 VMKHIPGADPELVLLNHYYEELDRIPLSEMTRAEINKLLAEL 74 ++K P+L+L+ E D IP+S++ ++KL L Sbjct: 3484528 IVKTTNDLKPDLILITGDLIERDPIPISQLYNKHLSKLKVSL 3484653 >gi|93569058|gb|CM000155.2| Dictyostelium discoideum AX4 chromosome 6, whole genome shotgun sequence Length = 3602379 Score = 28.1 bits (61), Expect = 1.1 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -3 Query: 28 LYHNLVMKHIPGADPELVLLNHYY 51 L+H+L+ HI D + + LN+YY Sbjct: 1074112 LFHSLISNHIKSVDLDYLHLNYYY 1074041 >gi|93569092|gb|CM000152.2| Dictyostelium discoideum AX4 chromosome 3, whole genome shotgun sequence Length = 6357299 Score = 26.6 bits (57), Expect = 3.2 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = -1 Query: 18 VKAFVTQDIPLYHNLVMKHIPGADPELVLLNH-YYEELD 55 V F+ D P NL+++ P P+LVLL+H Y+++D Sbjct: 4694366 VHGFLHSD-PHPGNLLVRKTPNGKPDLVLLDHGLYKKID 4694253 >gi|256541943|gb|CM000151.3| Dictyostelium discoideum AX4 chromosome 2, whole genome shotgun sequence Length = 8484197 Score = 25.4 bits (54), Expect = 7.1 Identities = 18/74 (24%), Positives = 38/74 (51%), Gaps = 2/74 (2%) Frame = -2 Query: 3 RVETCGGXQLNRMREVKAFVTQDIPLYHNLVMKHIPGADPELVLLNHYYEELDRIPLSEM 62 R+ET +E + ++I L H ++++ + + Y+E L ++ L+++ Sbjct: 7377934 RLETLNYLIETFKKETNKSINKEIELSHEVLLQSL-----DSTCEIEYHERLFKLCLNDL 7377770 Query: 63 TRAEIN--KLLAEL 74 R+EIN +LL +L Sbjct: 7377769 KRSEINIARLLGKL 7377728 Database: D.discoideum_AX4/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 33,943,072 Number of sequences in database: 6 Lambda K H 0.323 0.140 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,084,878 Number of Sequences: 6 Number of extensions: 44033 Number of successful extensions: 155 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 120 Number of HSP's gapped (non-prelim): 125 length of query: 77 length of database: 11,314,357 effective HSP length: 52 effective length of query: 25 effective length of database: 11,314,045 effective search space: 282851125 effective search space used: 282851125 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (25.0 bits)