TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= seed12.Q8H6T5_CHLRE/24-103 (80 letters) Database: D.discoideum_AX4/genome.fa 6 sequences; 33,943,072 total letters Searching......done Score E Sequences producing significant alignments: (bits) Value gi|93569114|gb|CM000150.2| Dictyostelium discoideum AX4 chromoso... 32 0.058 gi|93569092|gb|CM000152.2| Dictyostelium discoideum AX4 chromoso... 30 0.22 gi|93569058|gb|CM000155.2| Dictyostelium discoideum AX4 chromoso... 25 7.1 >gi|93569114|gb|CM000150.2| Dictyostelium discoideum AX4 chromosome 1, whole genome shotgun sequence Length = 4923596 Score = 32.3 bits (72), Expect = 0.058 Identities = 26/79 (32%), Positives = 35/79 (44%), Gaps = 6/79 (7%) Frame = +1 Query: 1 RGEFISCPGXRLNHLPEVKKFIRGDIEKDKAYENLTVNFVPGRTPELVLYDEN------G 54 RGE ++ G +N P +KK G +T + V +VL D+N G Sbjct: 1131775 RGEIVAVTGDGVNDSPALKKADLG------CAMGITGSDVAKEAASIVLLDDNFASIIAG 1131936 Query: 55 VEIERMFVDKLKYDELHTL 73 VE RM DKLK +TL Sbjct: 1131937 VEEGRMIFDKLKKSICYTL 1131993 Score = 28.1 bits (61), Expect = 1.1 Identities = 20/67 (29%), Positives = 28/67 (41%), Gaps = 11/67 (16%) Frame = +2 Query: 3 EFISCPGXRLNHLPEVKKFIRGDIEKDKAY-----------ENLTVNFVPGRTPELVLYD 51 E ++C + L V GD+EKDK Y L + G PE ++ Sbjct: 2046389 EHLTCFAGGMYALAAVSNITGGDVEKDKLYMKVGEEVTKTCTKLYLTSATGLGPETAYFN 2046568 Query: 52 ENGVEIE 58 +NG EIE Sbjct: 2046569 QNG-EIE 2046586 >gi|93569092|gb|CM000152.2| Dictyostelium discoideum AX4 chromosome 3, whole genome shotgun sequence Length = 6357299 Score = 30.4 bits (67), Expect = 0.22 Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 13/69 (18%) Frame = +2 Query: 25 DIEKDKAYENL----TVNFVPGRTPELV---------LYDENGVEIERMFVDKLKYDELH 71 D++++K ++L T + +PG T L+ L+D G++ R + L DEL Sbjct: 4699880 DLDREKLLKSLQSKITTSVLPGTTLNLLSLPLWDNSTLFDTPGIDNPRQMIKNLTIDELK 4700059 Query: 72 TLVQSKGFK 80 ++ SK K Sbjct: 4700060 QVIPSKRIK 4700086 Score = 28.5 bits (62), Expect = 0.83 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = -2 Query: 8 PGXRLNHLPEVKKFI-RGDIEKDKAYENLTVNFVPGRTPELVLYDENGV 55 P LN + K + +G+ N+TV F PG + YDE GV Sbjct: 3610258 PNFLLNSIDTSKPLVVKGNFSDGSTLNNITVIFPPGSGTFRLYYDETGV 3610112 Score = 27.7 bits (60), Expect = 1.4 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 7/46 (15%) Frame = -2 Query: 42 GRTPELVL------YDENGVE-IERMFVDKLKYDELHTLVQSKGFK 80 G+ P ++L YD N ++ I+ +D LKY +L S GFK Sbjct: 3249082 GQFPRVLLSYLSIDYDNNYIDKIDENIIDDLKYGQLPLYTDSNGFK 3248945 Score = 26.6 bits (57), Expect = 3.2 Identities = 8/18 (44%), Positives = 17/18 (94%) Frame = -3 Query: 17 EVKKFIRGDIEKDKAYEN 34 E+K+++RGD+++ KA++N Sbjct: 4549089 EIKRYVRGDMQEVKAHKN 4549036 Score = 25.8 bits (55), Expect = 5.4 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = -1 Query: 8 PGXRLNHLPEVKKFIRGDIEKDKAYE--NLTVNFVPGRTPELVLYDENG 54 P +N + K F+ D +++ N+TV F PG + YDE G Sbjct: 3632891 PNFLINSIDVNKPFVVKGNFSDPSFDCNNITVTFPPGSGKFRLYYDETG 3632745 >gi|93569058|gb|CM000155.2| Dictyostelium discoideum AX4 chromosome 6, whole genome shotgun sequence Length = 3602379 Score = 25.4 bits (54), Expect = 7.1 Identities = 13/49 (26%), Positives = 25/49 (51%) Frame = -2 Query: 18 VKKFIRGDIEKDKAYENLTVNFVPGRTPELVLYDENGVEIERMFVDKLK 66 + K ++ + + K + VN++PG +D +G+ IE+ KLK Sbjct: 2350880 LNKILKDIVNRYKVLKGFKVNYIPG-------WDCHGLPIEQQAFKKLK 2350755 Database: D.discoideum_AX4/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 33,943,072 Number of sequences in database: 6 Lambda K H 0.319 0.143 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,414,242 Number of Sequences: 6 Number of extensions: 23950 Number of successful extensions: 103 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 85 Number of HSP's gapped (non-prelim): 35 length of query: 80 length of database: 11,314,357 effective HSP length: 55 effective length of query: 25 effective length of database: 11,314,027 effective search space: 282850675 effective search space used: 282850675 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)