TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= seed10.Q7Q7W5_ANOGA/74-151 (78 letters) Database: D.discoideum_AX4/genome.fa 6 sequences; 33,943,072 total letters Searching......done Score E Sequences producing significant alignments: (bits) Value gi|93569114|gb|CM000150.2| Dictyostelium discoideum AX4 chromoso... 28 1.4 gi|93569092|gb|CM000152.2| Dictyostelium discoideum AX4 chromoso... 25 7.1 >gi|93569114|gb|CM000150.2| Dictyostelium discoideum AX4 chromosome 1, whole genome shotgun sequence Length = 4923596 Score = 27.7 bits (60), Expect = 1.4 Identities = 13/41 (31%), Positives = 24/41 (58%), Gaps = 3/41 (7%) Frame = -2 Query: 13 GAYPQIQAFIKS---DRPAKFPNLTIKYVRGLDPIVKLMDE 50 G+YPQ+Q +KS + KF +L IK + +D ++ ++ Sbjct: 2098672 GSYPQLQCIVKSLIESQSFKFDSLVIKLLVSIDNTLRFSND 2098550 >gi|93569092|gb|CM000152.2| Dictyostelium discoideum AX4 chromosome 3, whole genome shotgun sequence Length = 6357299 Score = 25.4 bits (54), Expect = 7.1 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -2 Query: 12 FGAYPQIQAFIKSDRPAKFPNLTIKYVRGLDPIV 45 F YP++ A + +D P+ +TI+ + L P+V Sbjct: 6338155 FSVYPKL*AVLNNDSPSLQMKITIEPIFVLSPLV 6338054 Database: D.discoideum_AX4/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 33,943,072 Number of sequences in database: 6 Lambda K H 0.320 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,443,258 Number of Sequences: 6 Number of extensions: 20448 Number of successful extensions: 73 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 67 Number of HSP's gapped (non-prelim): 21 length of query: 78 length of database: 11,314,357 effective HSP length: 53 effective length of query: 25 effective length of database: 11,314,039 effective search space: 282850975 effective search space used: 282850975 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)