TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= seed10.Q7Q7W5_ANOGA/74-151 (78 letters) Database: A.rara/genome.fa 3231 sequences; 1,450,095 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|330849494|gb|ADNL01001109.1| Astrammina rara contig01302, who... 23 1.5 gi|330850544|gb|ADNL01000059.1| Astrammina rara contig00062, who... 22 3.3 gi|330849481|gb|ADNL01001122.1| Astrammina rara contig01317, who... 21 5.7 gi|330848721|gb|ADNL01001882.1| Astrammina rara contig02237, who... 20 9.7 >gi|330849494|gb|ADNL01001109.1| Astrammina rara contig01302, whole genome shotgun sequence Length = 476 Score = 23.1 bits (48), Expect = 1.5 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = -2 Query: 35 IKYVRGLDPIVKLMDEQGNVKETLSINKWNTDTVQEFFETRLAK 78 +K +R + P ++++ K L KW TVQE + R K Sbjct: 199 LKPIRIMIPTLRVLTR----KTKLRFGKWKDYTVQELLDLRRQK 80 >gi|330850544|gb|ADNL01000059.1| Astrammina rara contig00062, whole genome shotgun sequence Length = 2381 Score = 21.9 bits (45), Expect = 3.3 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -1 Query: 52 GNVKETLSINKWNTDT 67 G ++ETL KW+ DT Sbjct: 848 GRLRETLQSAKWSYDT 801 >gi|330849481|gb|ADNL01001122.1| Astrammina rara contig01317, whole genome shotgun sequence Length = 352 Score = 21.2 bits (43), Expect = 5.7 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 3 AVLEVCTCKFGAYPQIQ 19 A VC C F +PQI+ Sbjct: 271 ATCNVCYCVFCTHPQIR 321 >gi|330848721|gb|ADNL01001882.1| Astrammina rara contig02237, whole genome shotgun sequence Length = 194 Score = 20.4 bits (41), Expect = 9.7 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 58 LSINKWNTDTVQEF 71 +SI W T+T+Q F Sbjct: 104 ISITSWLTNTIQYF 145 Database: A.rara/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 1,450,095 Number of sequences in database: 3231 Lambda K H 0.320 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 120,875 Number of Sequences: 3231 Number of extensions: 1019 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 78 length of database: 483,365 effective HSP length: 43 effective length of query: 35 effective length of database: 344,432 effective search space: 12055120 effective search space used: 12055120 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 41 (20.4 bits)