TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= seed1.SELM_MOUSE/39-115 (77 letters) Database: L.tarentolae/genome.fa 7267 sequences; 31,598,840 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Lt_contig4284 | | 1 to 7498 28 0.78 Lt_contig4741 | | 1 to 5842 26 3.9 Lt_contig20 | | 1 to 17256 26 5.0 Lt_contig4474 | | 1 to 5276 25 6.6 Lt_contig6411 | | 1 to 19267 25 6.6 >Lt_contig4284 | | 1 to 7498 Length = 7498 Score = 28.5 bits (62), Expect = 0.78 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = -2 Query: 4 VETCGGXQLNRLKEVKAFVTEDIQLYHNLVMKHLPGADPELVLLSRNYQELERI 57 V CGG + + A V+ ++ + + H+P A P L +L Q+LER+ Sbjct: 7107 VSLCGGRPAAQRPQPAAQVSRQLRSHGQVHASHVPAAQPSLPVL----QDLERL 6958 >Lt_contig4741 | | 1 to 5842 Length = 5842 Score = 26.2 bits (56), Expect = 3.9 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +1 Query: 31 NLVMKHLPGADPELVLLSRNYQELERIPLSQMTRDEINAL 70 ++ M +D +VL++R Y +L R+P + + E NAL Sbjct: 2128 DVTMGATEASDDGIVLMARVYAQLSRLPSNVLDSIEKNAL 2247 >Lt_contig20 | | 1 to 17256 Length = 17256 Score = 25.8 bits (55), Expect = 5.0 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +1 Query: 24 EDIQLYHNLVMKHLPGADPELVLLSRNYQELERIPLSQM 62 ++ L + L++ L G D L+ NY L ++PL Q+ Sbjct: 15160 DEPHLVYQLLVALLAGDDVPLLRCCHNYLRLRQLPLGQL 15276 >Lt_contig4474 | | 1 to 5276 Length = 5276 Score = 25.4 bits (54), Expect = 6.6 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 35 KHLPGADPELVLLSRNYQELER 56 +HLPGA P L L SR + ++R Sbjct: 2878 RHLPGAVPVLTLASRCVRPMQR 2943 >Lt_contig6411 | | 1 to 19267 Length = 19267 Score = 25.4 bits (54), Expect = 6.6 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -3 Query: 18 VKAFVTEDIQLYHNLVMKHLPGADPELVLLSRNYQEL 54 V FV EDI L+ ++ PG + R YQEL Sbjct: 4748 VPKFVAEDIPLFRGIMQDLFPG----VTFPEREYQEL 4650 Database: L.tarentolae/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 31,598,840 Number of sequences in database: 7267 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,377,460 Number of Sequences: 7267 Number of extensions: 21482 Number of successful extensions: 93 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 93 length of query: 77 length of database: 10,532,946 effective HSP length: 51 effective length of query: 26 effective length of database: 10,162,329 effective search space: 264220554 effective search space used: 264220554 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)