TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= seed1.SELM_MOUSE/39-115 (77 letters) Database: G.niphandrodes/genome.fa 3680 sequences; 15,362,869 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|338241722|gb|AFNH01002304.1| Gregarina niphandrodes asmbl.305... 24 9.3 gi|338242544|gb|AFNH01001893.1| Gregarina niphandrodes asmbl.267... 24 9.3 >gi|338241722|gb|AFNH01002304.1| Gregarina niphandrodes asmbl.3051, whole genome shotgun sequence Length = 18857 Score = 23.9 bits (50), Expect = 9.3 Identities = 15/75 (20%), Positives = 34/75 (45%), Gaps = 2/75 (2%) Frame = +2 Query: 4 VETCGGXQLNRLKEVKAFVTEDIQLYH--NLVMKHLPGADPELVLLSRNYQELERIPLSQ 61 + C LN + ++ T+ ++ + +L ++ G L +++NY +L L+ Sbjct: 7217 IPECATQWLNVPRVMEPLATKLVEFFERRDLAWENYTGVAKLLTAVAKNYDDLRTFKLAF 7396 Query: 62 MTRDEINALVQELGF 76 + N + ELG+ Sbjct: 7397 IHGSNDNLVKPELGW 7441 >gi|338242544|gb|AFNH01001893.1| Gregarina niphandrodes asmbl.2678, whole genome shotgun sequence Length = 10832 Score = 23.9 bits (50), Expect = 9.3 Identities = 6/18 (33%), Positives = 16/18 (88%) Frame = +2 Query: 59 LSQMTRDEINALVQELGF 76 L +++RD+++ +++E+GF Sbjct: 9461 LDELSRDQLSQMIEEIGF 9514 Database: G.niphandrodes/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 15,362,869 Number of sequences in database: 3680 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,200,399 Number of Sequences: 3680 Number of extensions: 12178 Number of successful extensions: 35 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of query: 77 length of database: 5,120,956 effective HSP length: 51 effective length of query: 26 effective length of database: 4,933,276 effective search space: 128265176 effective search space used: 128265176 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)