TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= seed1.SELM_MOUSE/39-115 (77 letters) Database: A.rara/genome.fa 3231 sequences; 1,450,095 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|330850216|gb|ADNL01000387.1| Astrammina rara contig00421, who... 24 0.68 gi|330848000|gb|ADNL01002603.1| Astrammina rara contig03080, who... 23 2.0 gi|330850572|gb|ADNL01000031.1| Astrammina rara contig00032, who... 22 2.6 gi|330849874|gb|ADNL01000729.1| Astrammina rara contig00833, who... 22 4.4 gi|330848940|gb|ADNL01001663.1| Astrammina rara contig01974, who... 20 9.8 >gi|330850216|gb|ADNL01000387.1| Astrammina rara contig00421, whole genome shotgun sequence Length = 1448 Score = 24.3 bits (51), Expect = 0.68 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = -2 Query: 24 EDIQLYHNLVMKHLPGADPELVLLSRNYQELERIPLSQMTR 64 E + YH L ++ L + LVL+ R+ + +P S + R Sbjct: 349 EKLHGYHTLHLRRLGQVELSLVLVVRHISAAQPVPQSTIPR 227 >gi|330848000|gb|ADNL01002603.1| Astrammina rara contig03080, whole genome shotgun sequence Length = 8271 Score = 22.7 bits (47), Expect = 2.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 33 VMKHLPGADPELVLLSRNYQELER 56 V KH PGA ++ RNY+ E+ Sbjct: 6507 VEKHFPGAQESILDWFRNYKVREQ 6578 >gi|330850572|gb|ADNL01000031.1| Astrammina rara contig00032, whole genome shotgun sequence Length = 3405 Score = 22.3 bits (46), Expect = 2.6 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 26 IQLYHNLVMKHLPGADPELVLLSR 49 I+LY +K+ P A PEL+ L + Sbjct: 1956 IELYSG*YIKYQPFAQPELLSLKK 2027 >gi|330849874|gb|ADNL01000729.1| Astrammina rara contig00833, whole genome shotgun sequence Length = 718 Score = 21.6 bits (44), Expect = 4.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 28 LYHNLVMKHLPGADPEL 44 L+H + + LPGA P L Sbjct: 706 LFHKVSKRFLPGAPPPL 656 >gi|330848940|gb|ADNL01001663.1| Astrammina rara contig01974, whole genome shotgun sequence Length = 170 Score = 20.4 bits (41), Expect = 9.8 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +2 Query: 18 VKAFVTEDIQLYHNLVMKHLP 38 + A T + L+H LV +H+P Sbjct: 50 ILALGTRCLLLFHALVTQHVP 112 Database: A.rara/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 1,450,095 Number of sequences in database: 3231 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 102,487 Number of Sequences: 3231 Number of extensions: 886 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 77 length of database: 483,365 effective HSP length: 42 effective length of query: 35 effective length of database: 347,663 effective search space: 12168205 effective search space used: 12168205 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 41 (20.4 bits)