TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000012_1.0 (235 letters) Database: P.polycephalum/genome.fa 297,657 sequences; 319,018,052 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig145269 416 416 48 4e-05 Contig4808 7720 24475 48 4e-05 Contig1663 17897 32807 33 1.4 Contig932 11407 11917 31 5.5 Contig3439 10051 22151 30 7.1 >Contig145269 416 416 Length = 416 Score = 47.8 bits (112), Expect = 4e-05 Identities = 20/42 (47%), Positives = 29/42 (69%) Frame = +1 Query: 92 QVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEEL 133 +VG+ GG NPTYK+VC+ TGHAEV+ V Y +++ +L Sbjct: 160 RVGYQGGDAKNPTYKQVCTGNTGHAEVLVVEYDDTKVNYADL 285 >Contig4808 7720 24475 Length = 24475 Score = 47.8 bits (112), Expect = 4e-05 Identities = 20/42 (47%), Positives = 29/42 (69%) Frame = -1 Query: 92 QVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEEL 133 +VG+ GG NPTYK+VC+ TGHAEV+ V Y +++ +L Sbjct: 13672 RVGYQGGDAKNPTYKQVCTGNTGHAEVLVVEYDDTKVNYADL 13547 Score = 40.0 bits (92), Expect = 0.009 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -2 Query: 201 FYYAEDYHQQYLSKNPNGYC 220 FY AEDYHQ+YL NP GYC Sbjct: 9558 FYTAEDYHQKYLEANPGGYC 9499 >Contig1663 17897 32807 Length = 32807 Score = 32.7 bits (73), Expect = 1.4 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -1 Query: 76 WGAERKFWVLKGVYSTQVGFAGG 98 WG ER FW +G+Y GF GG Sbjct: 17024 WGMERSFWGWEGIYGGMGGFLGG 16956 >Contig932 11407 11917 Length = 11917 Score = 30.8 bits (68), Expect = 5.5 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 2/69 (2%) Frame = -3 Query: 60 PFPEGTQMAVFGMGXFWGAERKFWVLKGVYSTQVGFAGGY--TSNPTYKEVCSEKTGHAE 117 PF EG +++ FG G E +W + + F + TS P+ KEV K Sbjct: 5153 PF*EGCELSDFGELVGGGGEGGWWCWRWGVHRVIHFCRDFSATSFPSMKEVIWAKASAVL 4974 Query: 118 VVRVVYQPE 126 + RV Y+P+ Sbjct: 4973 LSRVSYEPK 4947 >Contig3439 10051 22151 Length = 22151 Score = 30.4 bits (67), Expect = 7.1 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = +2 Query: 72 MGXFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRV 121 + FWG E+K W + S+ F N +Y + C +T + +V+V Sbjct: 773 LSYFWGTEKKIWRKNALISS---FVKNENENVSYGKTCDVRTVYYALVKV 913 Database: P.polycephalum/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 319,018,052 Number of sequences in database: 297,657 Lambda K H 0.316 0.133 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,590,380 Number of Sequences: 297657 Number of extensions: 1410831 Number of successful extensions: 7283 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7010 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7279 length of query: 235 length of database: 106,339,350 effective HSP length: 110 effective length of query: 125 effective length of database: 73,597,080 effective search space: 9199635000 effective search space used: 9199635000 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 66 (30.0 bits)