TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000012_1.0 (235 letters) Database: A.rara/genome.fa 3231 sequences; 1,450,095 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|330847779|gb|ADNL01002824.1| Astrammina rara contig00179, who... 25 1.8 gi|330847967|gb|ADNL01002636.1| Astrammina rara contig03118, who... 25 1.8 gi|330848902|gb|ADNL01001701.1| Astrammina rara contig02019, who... 23 6.7 gi|330848015|gb|ADNL01002588.1| Astrammina rara contig03063, who... 22 8.8 gi|330848257|gb|ADNL01002346.1| Astrammina rara contig02799, who... 22 8.8 gi|330849473|gb|ADNL01001130.1| Astrammina rara contig01327, who... 22 8.8 gi|330849793|gb|ADNL01000810.1| Astrammina rara contig00930, who... 22 8.8 >gi|330847779|gb|ADNL01002824.1| Astrammina rara contig00179, whole genome shotgun sequence Length = 9026 Score = 24.6 bits (52), Expect = 1.8 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 6 RRACQLLLLHSLFPVPRMGNSASN 29 RR C L + F V M NSASN Sbjct: 5477 RRGCNHLTMEPAFIVSHMENSASN 5548 >gi|330847967|gb|ADNL01002636.1| Astrammina rara contig03118, whole genome shotgun sequence Length = 731 Score = 24.6 bits (52), Expect = 1.8 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 69 VFGMGXFWGAERKFWVLKGVYSTQVGFA 96 +FG+G WG+E +VL+ + G A Sbjct: 152 LFGIGNIWGSEMLLYVLRSFIMDRWGKA 69 >gi|330848902|gb|ADNL01001701.1| Astrammina rara contig02019, whole genome shotgun sequence Length = 196 Score = 22.7 bits (47), Expect = 6.7 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 4 ATRRACQLLLLHSLFPVP 21 ATR AC+++ L+ F VP Sbjct: 110 ATRSACKMISLYVKFSVP 57 >gi|330848015|gb|ADNL01002588.1| Astrammina rara contig03063, whole genome shotgun sequence Length = 548 Score = 22.3 bits (46), Expect = 8.8 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = +2 Query: 141 HDPTQGMRQGNDHGTQYRSAIYPT 164 HDP M G + T A+Y T Sbjct: 455 HDPMYDMEVGPNFSTSQTQAVYST 526 >gi|330848257|gb|ADNL01002346.1| Astrammina rara contig02799, whole genome shotgun sequence Length = 1322 Score = 22.3 bits (46), Expect = 8.8 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +1 Query: 34 QEALPGRKEQTPVAAKHHVNGNRT 57 +E +PG EQ+P + N N T Sbjct: 502 EEIVPGSTEQSPAPIEEAANKNLT 573 >gi|330849473|gb|ADNL01001130.1| Astrammina rara contig01327, whole genome shotgun sequence Length = 779 Score = 22.3 bits (46), Expect = 8.8 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -3 Query: 148 RQGNDHGTQYRSAIYPTSAKQMEAALSSKEN 178 +QG++ T+Y + + SAK + S K N Sbjct: 699 QQGSNRETEYNTLSFDESAKGWTSLFSYKPN 607 >gi|330849793|gb|ADNL01000810.1| Astrammina rara contig00930, whole genome shotgun sequence Length = 390 Score = 22.3 bits (46), Expect = 8.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 100 TSNPTYKEVCSEKTG 114 +S+PT +EVC E G Sbjct: 274 SSSPTSREVCGESQG 318 Database: A.rara/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 1,450,095 Number of sequences in database: 3231 Lambda K H 0.316 0.133 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 428,745 Number of Sequences: 3231 Number of extensions: 5326 Number of successful extensions: 24 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of query: 235 length of database: 483,365 effective HSP length: 71 effective length of query: 164 effective length of database: 253,964 effective search space: 41650096 effective search space used: 41650096 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)