TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|332657964|gb|AEE83364.1| selenium-binding protein 2 [Arabidopsis thaliana] (487 letters) Database: G.niphandrodes/genome.fa 3680 sequences; 15,362,869 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|338242247|gb|AFNH01002041.1| Gregarina niphandrodes asmbl.281... 30 1.4 gi|338240535|gb|AFNH01002898.1| Gregarina niphandrodes asmbl.360... 28 7.1 gi|338241598|gb|AFNH01002366.1| Gregarina niphandrodes asmbl.311... 28 7.1 gi|338241041|gb|AFNH01002646.1| Gregarina niphandrodes asmbl.337... 28 9.3 gi|338242722|gb|AFNH01001804.1| Gregarina niphandrodes asmbl.259... 28 9.3 gi|338242740|gb|AFNH01001795.1| Gregarina niphandrodes asmbl.258... 28 9.3 >gi|338242247|gb|AFNH01002041.1| Gregarina niphandrodes asmbl.2813, whole genome shotgun sequence Length = 10920 Score = 30.4 bits (67), Expect = 1.4 Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 6/54 (11%) Frame = +2 Query: 12 SNGKSKGCCKSGPGYATPLAA------MAGPREKLIYVTALYSGTGRDKPDYLA 59 + G+S+G C SGPG P AA A P + + G KP+ LA Sbjct: 3701 ATGRSRGLCVSGPGGKCPTAAGR*RRTNASPENSNALMPCVNRGPNLTKPEQLA 3862 >gi|338240535|gb|AFNH01002898.1| Gregarina niphandrodes asmbl.3605, whole genome shotgun sequence Length = 34762 Score = 28.1 bits (61), Expect = 7.1 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -2 Query: 3 TETVLATAVSNGKSKGCCKSGPGYATPLAAMAGPR 37 T ++ A V S GCC GP + L++ +G R Sbjct: 9705 TNSLQAETVGGSWSSGCCPIGPSWRPRLSSTSGSR 9601 >gi|338241598|gb|AFNH01002366.1| Gregarina niphandrodes asmbl.3110, whole genome shotgun sequence Length = 24708 Score = 28.1 bits (61), Expect = 7.1 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +3 Query: 68 PTFSSVIHRLKMPYIGDELHH 88 PT +++HRL+ P GD+ HH Sbjct: 22890 PTL*TLLHRLQEPEAGDQAHH 22952 >gi|338241041|gb|AFNH01002646.1| Gregarina niphandrodes asmbl.3371, whole genome shotgun sequence Length = 36982 Score = 27.7 bits (60), Expect = 9.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 282 GSALSSNMIRFFKNSDDTWSHEVVISVKPL 311 GSA+ N + F+N W+H+ V++V P+ Sbjct: 12563 GSAVLRNPL--FRNRKSVWAHDAVVTVSPI 12646 >gi|338242722|gb|AFNH01001804.1| Gregarina niphandrodes asmbl.2597, whole genome shotgun sequence Length = 10091 Score = 27.7 bits (60), Expect = 9.3 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +1 Query: 126 DPKAPSLYKVVEPKEIAEKTGLAFPHTSHCLASGDMLVSCLGD 168 DP V+ P + T L F CLA + SCLGD Sbjct: 9931 DPSRVGCLPVLLPNSLLPDTCLEFCLADSCLADSCLADSCLGD 10059 >gi|338242740|gb|AFNH01001795.1| Gregarina niphandrodes asmbl.2589, whole genome shotgun sequence Length = 34199 Score = 27.7 bits (60), Expect = 9.3 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -3 Query: 83 GDELHHTGWNSCS 95 GD HTGWNSCS Sbjct: 24786 GDGYPHTGWNSCS 24748 Database: G.niphandrodes/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 15,362,869 Number of sequences in database: 3680 Lambda K H 0.319 0.139 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,795,687 Number of Sequences: 3680 Number of extensions: 189156 Number of successful extensions: 848 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 426 Number of HSP's successfully gapped in prelim test: 61 Number of HSP's that attempted gapping in prelim test: 371 Number of HSP's gapped (non-prelim): 566 length of query: 487 length of database: 5,120,956 effective HSP length: 99 effective length of query: 388 effective length of database: 4,756,636 effective search space: 1845574768 effective search space used: 1845574768 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 60 (27.7 bits)