TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000025_1.0 # Protein # Selenoprotein T (SelT) # Homo sapiens # Complete (195 letters) Database: F.cylindrus/genome.fa 271 sequences; 80,540,407 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value scaffold_11 71 1e-12 scaffold_9 70 2e-12 >scaffold_11 Length = 1700871 Score = 71.2 bits (173), Expect = 1e-12 Identities = 43/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%) Frame = -3 Query: 44 QICVSUGYRRVFEEYMRVISQRYPDIR--IEGENYLPQPIYRHIASFLSVFKLVLIGLII 101 Q CVS G +R F + + Q +P++R + G+NY P PI + FLSV +L + + + Sbjct: 900676 QFCVS*GSKRNFLQVRDWLEQTFPELRGKVTGDNYPPPPIAELLMKFLSVIQLAGMAVAL 900497 Query: 102 VGKDPFAFFGMQAPSIWQWGQ---ENKVYACMMVFFLSNMIENQCMSTGAFEITLNDV-P 157 +G++ F F GM P W +G +N V + ++ + I N + + AFE+ L+ Sbjct: 900496 IGENVFRFIGMSRPPSW-YGDIVVKNAVPLGIGLYLIVPQILNGYIVSNAFEVVLDGTET 900320 Query: 158 VWSKLESGHLPSMQQLVQIL 177 ++SK+ +G +P+ + L+ L Sbjct: 900319 IFSKIATGRMPAAEDLIDPL 900260 >scaffold_9 Length = 2734635 Score = 70.5 bits (171), Expect = 2e-12 Identities = 43/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%) Frame = -3 Query: 44 QICVSUGYRRVFEEYMRVISQRYPDIR--IEGENYLPQPIYRHIASFLSVFKLVLIGLII 101 Q CVS G +R F + + Q +P++R + G+NY P PI + FLSV +L + + + Sbjct: 2406061 QFCVS*GSKRNFLQVRDWLEQTFPELRGKVTGDNYPPPPIAELLMKFLSVIQLAGMAVAL 2405882 Query: 102 VGKDPFAFFGMQAPSIWQWGQ---ENKVYACMMVFFLSNMIENQCMSTGAFEITLNDV-P 157 +G++ F F GM P W +G +N V + ++ + I N + + AFE+ L+ Sbjct: 2405881 MGENVFRFIGMSRPPSW-YGDIVVKNAVPLGIGLYLIVPQILNGYIVSNAFEVVLDGTET 2405705 Query: 158 VWSKLESGHLPSMQQLVQIL 177 ++SK+ +G +P+ + L+ L Sbjct: 2405704 IFSKIATGRMPAAEDLIDPL 2405645 Database: F.cylindrus/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 80,540,407 Number of sequences in database: 271 Lambda K H 0.325 0.137 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,450,877 Number of Sequences: 271 Number of extensions: 227536 Number of successful extensions: 1286 Number of sequences better than 1.0e-04: 2 Number of HSP's better than 0.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 1187 Number of HSP's gapped (non-prelim): 275 length of query: 195 length of database: 26,846,802 effective HSP length: 101 effective length of query: 94 effective length of database: 26,819,431 effective search space: 2521026514 effective search space used: 2521026514 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 104 (44.7 bits)