TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000059_1.0 # Protein # Selenoprotein R (SelR) # Caenorhabditis elegans # Complete (152 letters) Database: L.tarentolae/genome.fa 7267 sequences; 31,598,840 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Lt_contig5668 | | 1 to 2542 93 8e-20 >Lt_contig5668 | | 1 to 2542 Length = 2542 Score = 92.8 bits (229), Expect = 8e-20 Identities = 48/123 (39%), Positives = 67/123 (54%), Gaps = 2/123 (1%) Frame = -1 Query: 23 KDVKQTEWKSVLPNEVYRVARESGTETPHTGGFNDHFEKGRYVCLCCGSELFNSDAKFWA 82 KDV EW+ VL Y + RE GT+ P G +++ F++G YVC C + L+ S KF Sbjct: 1492 KDVSDAEWRRVLTAHEYHILREKGTD-PVGGKYDEVFDEGEYVCAGCQTPLYLSSMKFAC 1316 Query: 83 GCGWPAFSESVGQDANIVRIVDRSHGMHRTEVRCKTCDAHLGHVFNDG--PKETTGERYC 140 GCGWP F + + + VR G R E+ C C++HLGH+F P ER+C Sbjct: 1315 GCGWPGFYDCIPKK---VREQPDKDG-RRVEIVCNACNSHLGHIFRGEGFPNPPPNERHC 1148 Query: 141 INS 143 +NS Sbjct: 1147 VNS 1139 Database: L.tarentolae/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 31,598,840 Number of sequences in database: 7267 Lambda K H 0.319 0.134 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,430,518 Number of Sequences: 7267 Number of extensions: 163029 Number of successful extensions: 992 Number of sequences better than 1.0e-04: 1 Number of HSP's better than 0.0 without gapping: 969 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 990 length of query: 152 length of database: 10,532,946 effective HSP length: 91 effective length of query: 61 effective length of database: 9,871,649 effective search space: 602170589 effective search space used: 602170589 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 99 (42.7 bits)