TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000089_1.0 # Protein # Selenoprotein R (SelR) # Drosophila melanogaster # Complete (197 letters) Database: P.capsici/genome.fa 917 sequences; 64,023,748 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value PHYCAscaffold_33 93 3e-23 >PHYCAscaffold_33 Length = 640966 Score = 92.8 bits (229), Expect(2) = 3e-23 Identities = 50/125 (40%), Positives = 68/125 (54%), Gaps = 18/125 (14%) Frame = -2 Query: 1 MDNKSEKVTVNKEELRKRLTPVQYQVTQEAGTERPFTGCYNKHYEKGVYQCIVCHQDLFS 60 M + S+ V ++ EE ++RLTP+Q+QV + GTER TG YNKH E GVY C C +++ Sbjct: 179394 MSSNSDAVKLSDEEWKQRLTPMQFQVLRLKGTERAGTGEYNKHKETGVYVCAGCKTPVYT 179215 Query: 61 SETKYDSGCGWPAFNDVLDKG------------------KVTLHRDASIPGMVRTEVRCS 102 S TK+DSGCGWPAF D + V L A G RTE+ C+ Sbjct: 179214 STTKFDSGCGWPAFYDAIPGAIKVV*SKDLFYFDSIY*ILVLLQAVADADGR-RTEIMCA 179038 Query: 103 RCSAH 107 +C + Sbjct: 179037 KCDGY 179023 Score = 33.5 bits (75), Expect(2) = 3e-23 Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 2/30 (6%) Frame = -1 Query: 147 NAHMGHVF--EDGPKPTRKRYCINSASIEF 174 ++HMGHVF E PT +R+C+NS S+ F Sbjct: 178966 SSHMGHVFKGEGFETPTDERHCVNSVSLVF 178877 Database: P.capsici/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 64,023,748 Number of sequences in database: 917 Lambda K H 0.321 0.135 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,263,555 Number of Sequences: 917 Number of extensions: 356099 Number of successful extensions: 1728 Number of sequences better than 1.0e-04: 1 Number of HSP's better than 0.0 without gapping: 98 Number of HSP's successfully gapped in prelim test: 28 Number of HSP's that attempted gapping in prelim test: 1180 Number of HSP's gapped (non-prelim): 987 length of query: 197 length of database: 21,341,249 effective HSP length: 99 effective length of query: 98 effective length of database: 21,250,466 effective search space: 2082545668 effective search space used: 2082545668 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 103 (44.3 bits)