TBLASTN 2.2.13 [Nov-27-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= SPP00000023_1.0 # Protein # Methionine-R-sufoxide reductase 3
(SelR3) # Homo sapiens # Complete
         (192 letters)

Database: S.arctica/genome.fa 
           15,618 sequences; 121,588,341 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

supercont1.1467 of Sphaeroforma arctica JP610                          49   6e-06

>supercont1.1467 of Sphaeroforma arctica JP610
          Length = 14738

 Score = 49.3 bits (116), Expect = 6e-06
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 3/50 (6%)
 Frame = +3

Query: 120  FTDDFSY--GMHRVETSCSQCGAHLGHIFD-DGPRPTGKRYCINSAALSF 166
            F D   Y  G+ R+E  CSQCG HLGH+F+ +    T +R+C+NS ++ F
Sbjct: 2511 FIDPIIYRMGLKRIEIMCSQCGGHLGHVFEGEKFTDTNERHCVNSVSIKF 2660


  Database: S.arctica/genome.fa
    Posted date:  Nov 21, 2011  7:47 PM
  Number of letters in database: 121,588,341
  Number of sequences in database:  15,618
  
Lambda     K      H
   0.316    0.132    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 27,965,024
Number of Sequences: 15618
Number of extensions: 449362
Number of successful extensions: 1781
Number of sequences better than 1.0e-04: 1
Number of HSP's better than  0.0 without gapping: 1209
Number of HSP's successfully gapped in prelim test: 63
Number of HSP's that attempted gapping in prelim test: 421
Number of HSP's gapped (non-prelim): 1485
length of query: 192
length of database: 40,529,447
effective HSP length: 103
effective length of query: 89
effective length of database: 38,920,793
effective search space: 3463950577
effective search space used: 3463950577
frameshift window, decay const: 40,  0.1
T: 13
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 105 (45.1 bits)