TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000023_1.0 # Protein # Methionine-R-sufoxide reductase 3 (SelR3) # Homo sapiens # Complete (192 letters) Database: C.fasciculata/genome.fa 1089 sequences; 37,048,325 total letters Searching...................................................done Score E Sequences producing significant alignments: (bits) Value Cf_Contig980 | | 1 to 109705 89 2e-18 >Cf_Contig980 | | 1 to 109705 Length = 109705 Score = 89.4 bits (220), Expect = 2e-18 Identities = 49/126 (38%), Positives = 68/126 (53%), Gaps = 3/126 (2%) Frame = +2 Query: 47 QQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGW 106 + E + LTP QY + +EKGT+ G+Y + G Y C C TPL+ S KF G GW Sbjct: 4742 EAEWKAILTPTQYRILREKGTDPV-GGKYDDLFEDGEYVCAACKTPLYTSAMKFACGCGW 4918 Query: 107 PSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIF-DDGPR--PTGKRYCINSAA 163 P F D I D RVE C+ C +HLGH+F ++G R P +R+C+N+ + Sbjct: 4919 PGFWDCIPKTVRELPDKDG---RRVEIVCNACNSHLGHVFRNEGFRNPPPNERHCVNNTS 5089 Query: 164 LSFTPA 169 + F PA Sbjct: 5090 VIFIPA 5107 Database: C.fasciculata/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 37,048,325 Number of sequences in database: 1089 Lambda K H 0.316 0.132 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,785,890 Number of Sequences: 1089 Number of extensions: 172105 Number of successful extensions: 1138 Number of sequences better than 1.0e-04: 1 Number of HSP's better than 0.0 without gapping: 145 Number of HSP's successfully gapped in prelim test: 69 Number of HSP's that attempted gapping in prelim test: 819 Number of HSP's gapped (non-prelim): 590 length of query: 192 length of database: 12,349,441 effective HSP length: 95 effective length of query: 97 effective length of database: 12,245,986 effective search space: 1187860642 effective search space used: 1187860642 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 101 (43.5 bits)